(data stored in ACNUC13479 zone)

EMBL: AY086369

ID   AY086369; SV 1; linear; mRNA; STD; PLN; 609 BP.
XX
AC   AY086369;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-FEB-2006 (Rel. 86, Last updated, Version 5)
XX
DE   Arabidopsis thaliana clone 24619 mRNA, complete sequence.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-609
RX   PUBMED; 12093376.
RA   Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N.,
RA   Feldmann K.A., Flavell R.B., White O., Salzberg S.L.;
RT   "Full-length messenger RNA sequences greatly improve genome annotation";
RL   Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002).
XX
RN   [2]
RP   1-609
RA   Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.;
RT   "Features of Arabidopsis genes and genome discovered using full-length
RT   cDNAs";
RL   Plant Mol. Biol. 60(1):71-87(2006).
XX
RN   [3]
RP   1-609
RA   Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.;
RT   ;
RL   Submitted (11-MAR-2002) to the INSDC.
RL   Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA
XX
DR   MD5; 7389e65d6f8282cb7f0c4f729f225977.
XX
CC   This clone sequence is one of 5,000 Ceres full-length cDNAs made
CC   available to TIGR and Genbank. The following quality assessment of
CC   this set was done by comparison with known proteins: two percent of
CC   the clones are estimated to be 5'-truncated; less than one percent
CC   are 3'-truncated; approximately two percent represent alternative
CC   splice variants, including unspliced introns and spliced exons; one
CC   percent may contain premature stop codons; five percent may have
CC   frame shifts in a coding region. A sequence is considered to be
CC   5'-truncated if it lacks the translation initiation start (ATG). A
CC   sequence is considered to be 3'-truncated if it lacks the
CC   C-terminal end of the encoded protein. Please note that these cDNA
CC   sequences are derived from the Ws or LAer ecotypes and therefore
CC   may contain polymorphisms when compared to sequences from Col-0.
CC   Genset carried out the library production and sequencing of the
CC   full-length clones. Ceres, Inc. carried out the clustering of the
CC   5' sequences, selection of clones, and sequence assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..609
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone="24619"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        114..380
FT                   /codon_start=1
FT                   /product="putative small nuclear ribonucleoprotein E"
FT                   /db_xref="GOA:Q9ZV45"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027078"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZV45"
FT                   /protein_id="AAM64436.1"
FT                   /translation="MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRITG
FT                   FDEYMNLVLDEAEEVSIKKNTRKPLGRILLKGDNITLMMNTGK"
XX
SQ   Sequence 609 BP; 195 A; 96 C; 134 G; 184 T; 0 other;
     gaaaaatgtt gaaaaaagcg tattagcaga gggacaaacg ctttttaggg ttttagattt        60
     cctctgagag agaattttcg aaagcttcag agagatttcc aactacgtta gccatggcga       120
     gcaccaaagt tcaaaggatt atgacccaac ctatcaactt gatttttagg tttcttcaaa       180
     gtaaagctag gatccagatt tggctatttg agcagaaaga tttgaggatt gaaggaagaa       240
     tcactggttt tgacgaatac atgaatctag ttttggatga ggctgaagaa gtgagcatca       300
     agaagaacac caggaaacca cttggaagga ttttactcaa aggagacaac ataactctga       360
     tgatgaacac gggaaagtga tgtctgtctc aaacaactct cttcgatgac cttcaagctt       420
     atgttaaata tctgttgagt tcttcctcag cttaattggt acttgacgat accttctttt       480
     cttcaatgtc gtataatata ttgcaatgta gtgagtgaca aaggagcttg atcgaatcta       540
     gtggattggt tggttaaaac ttcaaaaaag agatttggtc ccttttggtt aaatctagtg       600
     taatttggc                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page