(data stored in ACNUC16935 zone)

EMBL: AY086967

ID   AY086967; SV 1; linear; mRNA; STD; PLN; 929 BP.
XX
AC   AY086967;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-FEB-2006 (Rel. 86, Last updated, Version 5)
XX
DE   Arabidopsis thaliana clone 3001 mRNA, complete sequence.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-929
RX   PUBMED; 12093376.
RA   Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N.,
RA   Feldmann K.A., Flavell R.B., White O., Salzberg S.L.;
RT   "Full-length messenger RNA sequences greatly improve genome annotation";
RL   Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002).
XX
RN   [2]
RP   1-929
RA   Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.;
RT   "Features of Arabidopsis genes and genome discovered using full-length
RT   cDNAs";
RL   Plant Mol. Biol. 60(1):71-87(2006).
XX
RN   [3]
RP   1-929
RA   Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.;
RT   ;
RL   Submitted (11-MAR-2002) to the INSDC.
RL   Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA
XX
DR   MD5; 9c14065da3b39613645310ae4445518f.
XX
CC   This clone sequence is one of 5,000 Ceres full-length cDNAs made
CC   available to TIGR and Genbank. The following quality assessment of
CC   this set was done by comparison with known proteins: two percent of
CC   the clones are estimated to be 5'-truncated; less than one percent
CC   are 3'-truncated; approximately two percent represent alternative
CC   splice variants, including unspliced introns and spliced exons; one
CC   percent may contain premature stop codons; five percent may have
CC   frame shifts in a coding region. A sequence is considered to be
CC   5'-truncated if it lacks the translation initiation start (ATG). A
CC   sequence is considered to be 3'-truncated if it lacks the
CC   C-terminal end of the encoded protein. Please note that these cDNA
CC   sequences are derived from the Ws or LAer ecotypes and therefore
CC   may contain polymorphisms when compared to sequences from Col-0.
CC   Genset carried out the library production and sequencing of the
CC   full-length clones. Ceres, Inc. carried out the clustering of the
CC   5' sequences, selection of clones, and sequence assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..929
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone="3001"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        67..756
FT                   /codon_start=1
FT                   /product="ubiquitin homolog"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q8LBW0"
FT                   /protein_id="AAM64530.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
FT                   LRLRGGF"
XX
SQ   Sequence 929 BP; 239 A; 227 C; 206 G; 253 T; 4 other;
     acaattcaga ttccaatttt ctcgaactct taaatcaatc tctcaaatct ctcaaccgtg        60
     atcaagatgc agatcttcgt taagactctc accggaaaga ctatcaccct cgaggtggaa       120
     agctctgaca ccatcgacaa cgttaaggcc aagatccagg ataaggaagg cattcctccg       180
     gatcagcaga gattgatctt cgccggaaaa cagctagagg atggccgtac gttggctgat       240
     tacaatatcc agaaggaatc caccctccat ttggttctcm gtctgcgtgg aggtatgcag       300
     atcttcgtta agactctcac sggaaagack atcactcttg aggtagagag ctctgacacc       360
     attgacaacg tcaaggccaa gatccaggat aaggaaggta tccctccgga ccagcagagg       420
     ttgatcttcg ccggtaaaca gttggaggat ggtcgtacct tggctgatta caacattcag       480
     aaggagtcga cccttcactt ggttttgcgt ctgcgtggag gtatgcagat cttcgttaag       540
     actttgaccg gmaagactat cactcttgaa gtggagagct ccgacaccat tgacaacgtg       600
     aaggccaaga tccaggacaa ggaaggtatc cctccggacc agcagcgtct catcttcgct       660
     ggaaagcagc ttgaggatgg acgtactttg gccgactaca acatccagaa ggagtctact       720
     cttcacttgg tcctccgtct ccgtggtggt ttctaaacct tgtctctctc tcttatggtt       780
     actgaaccaa gttcatgtct cgtttcatct agtactttgg tggtttatgt tttggggcca       840
     tgtacagcct ctgataaata attgatcgac tatgtttccg tttctttcat ctctcttttc       900
     tttcaaacaa caaatcgaac ttattctct                                         929
//

If you have problems or comments...

PBIL Back to PBIL home page