(data stored in SCRATCH zone)

EMBL: AY087164

ID   AY087164; SV 1; linear; mRNA; STD; PLN; 480 BP.
XX
AC   AY087164;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-FEB-2006 (Rel. 86, Last updated, Version 4)
XX
DE   Arabidopsis thaliana clone 32396 mRNA, complete sequence.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-480
RX   PUBMED; 12093376.
RA   Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N.,
RA   Feldmann K.A., Flavell R.B., White O., Salzberg S.L.;
RT   "Full-length messenger RNA sequences greatly improve genome annotation";
RL   Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002).
XX
RN   [2]
RP   1-480
RA   Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.;
RT   "Features of Arabidopsis genes and genome discovered using full-length
RT   cDNAs";
RL   Plant Mol. Biol. 60(1):71-87(2006).
XX
RN   [3]
RP   1-480
RA   Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.;
RT   ;
RL   Submitted (11-MAR-2002) to the INSDC.
RL   Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA
XX
DR   MD5; e77888ea714d48e0610b403d45aa6acc.
XX
CC   This clone sequence is one of 5,000 Ceres full-length cDNAs made
CC   available to TIGR and Genbank. The following quality assessment of
CC   this set was done by comparison with known proteins: two percent of
CC   the clones are estimated to be 5'-truncated; less than one percent
CC   are 3'-truncated; approximately two percent represent alternative
CC   splice variants, including unspliced introns and spliced exons; one
CC   percent may contain premature stop codons; five percent may have
CC   frame shifts in a coding region. A sequence is considered to be
CC   5'-truncated if it lacks the translation initiation start (ATG). A
CC   sequence is considered to be 3'-truncated if it lacks the
CC   C-terminal end of the encoded protein. Please note that these cDNA
CC   sequences are derived from the Ws or LAer ecotypes and therefore
CC   may contain polymorphisms when compared to sequences from Col-0.
CC   Genset carried out the library production and sequencing of the
CC   full-length clones. Ceres, Inc. carried out the clustering of the
CC   5' sequences, selection of clones, and sequence assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..480
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone="32396"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        123..437
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /db_xref="GOA:Q8LBK1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8LBK1"
FT                   /protein_id="AAM64720.1"
FT                   /translation="MESSLHSVIFLGLLATILVTTNGQGDGTGLNAEEMWPVEVGMEYR
FT                   VWRRKLMTPLELCLECKCCSSTTCATMPCCFGINCQLPNKPFGVCAFVPKSCHCNSCSI
FT                   "
XX
SQ   Sequence 480 BP; 110 A; 103 C; 123 G; 144 T; 0 other;
     gccttagctg tgtatgattg gacttgtaga atctggtgga gtgacccact aaaccatgtc        60
     tctttttatc caccacacag atcttggtat cgcctaatct ttctagagcg actgggagaa       120
     gtatggagtc tagcttgcat agtgtgattt tcttaggttt gcttgcgacg attctggtta       180
     cgaccaatgg ccaaggagac gggacggggc taaatgcaga agaaatgtgg ccagtggagg       240
     tggggatgga gtatagagta tggaggagaa agctgatgac gccattggag ctgtgcttgg       300
     agtgcaaatg ctgctcctcc accacttgtg ccaccatgcc ttgctgtttc ggcatcaatt       360
     gccagcttcc caacaagcca tttggcgttt gtgcctttgt tcccaagtca tgccattgta       420
     attcttgctc catttgactg tatttttgct tctaccaaca tgatgctata aactagattc       480
//

If you have problems or comments...

PBIL Back to PBIL home page