(data stored in SCRATCH zone)

EMBL: AY087244

ID   AY087244; SV 1; linear; mRNA; STD; PLN; 917 BP.
XX
AC   AY087244;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-FEB-2006 (Rel. 86, Last updated, Version 4)
XX
DE   Arabidopsis thaliana clone 33227 mRNA, complete sequence.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-917
RX   PUBMED; 12093376.
RA   Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N.,
RA   Feldmann K.A., Flavell R.B., White O., Salzberg S.L.;
RT   "Full-length messenger RNA sequences greatly improve genome annotation";
RL   Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002).
XX
RN   [2]
RP   1-917
RA   Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.;
RT   "Features of Arabidopsis genes and genome discovered using full-length
RT   cDNAs";
RL   Plant Mol. Biol. 60(1):71-87(2006).
XX
RN   [3]
RP   1-917
RA   Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.;
RT   ;
RL   Submitted (11-MAR-2002) to the INSDC.
RL   Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA
XX
DR   MD5; 8ca455299b3b9bd127639957bc4e20eb.
XX
CC   This clone sequence is one of 5,000 Ceres full-length cDNAs made
CC   available to TIGR and Genbank. The following quality assessment of
CC   this set was done by comparison with known proteins: two percent of
CC   the clones are estimated to be 5'-truncated; less than one percent
CC   are 3'-truncated; approximately two percent represent alternative
CC   splice variants, including unspliced introns and spliced exons; one
CC   percent may contain premature stop codons; five percent may have
CC   frame shifts in a coding region. A sequence is considered to be
CC   5'-truncated if it lacks the translation initiation start (ATG). A
CC   sequence is considered to be 3'-truncated if it lacks the
CC   C-terminal end of the encoded protein. Please note that these cDNA
CC   sequences are derived from the Ws or LAer ecotypes and therefore
CC   may contain polymorphisms when compared to sequences from Col-0.
CC   Genset carried out the library production and sequencing of the
CC   full-length clones. Ceres, Inc. carried out the clustering of the
CC   5' sequences, selection of clones, and sequence assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..917
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone="33227"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        86..784
FT                   /codon_start=1
FT                   /product="caffeoyl-CoA O-methyltransferase-like protein"
FT                   /db_xref="GOA:Q9C5D7"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C5D7"
FT                   /protein_id="AAM64800.1"
FT                   /translation="MAKDEAKGLLKSEELYKYILETSVYPREPEVLRELRNITHNHPQA
FT                   GMATAPDAGQLMGMLLNLVNARKTIEVGVFTGYSLLLTALTLPEDGKVIAIDMNRDSYE
FT                   IGLPVIKKAGVEHKIDFKESEALPALDELLNNKVNEGGFXXAFVDADKLNYWNYHERLI
FT                   RLIKVGGIIVYDNTLWGGSVAEPDSSTPEWRIEVKKATLELNKKLSADQRVQISQAALG
FT                   DGITICRRLY"
XX
SQ   Sequence 917 BP; 253 A; 166 C; 239 G; 255 T; 4 other;
     accagattgt agtggatgat cggaaactaa gacttcagtc atctgagact ttacagtgtt        60
     tgaggaacga agattgtgag acacaatggc taaggatgaa gccaagggat tgctgaaaag       120
     tgaagagctc tataaatata tactggagac tagtgtgtac ccacgcgagc cagaggttct       180
     cagggagctt aggaacatta ctcataacca ccctcaagct ggtatggcta ctgcaccaga       240
     cgctggccag ttgatgggga tgctgctgaa tctggtaaat gcaagaaaga ctatcgaggt       300
     tggggttttc actggatact ctcttctcct cactgctctt acgctaccag aagatggcaa       360
     ggttatcgcc attgacatga atagagactc gtatgaaata ggattgccgg ttataaagaa       420
     agctggtgtt gaacacaaaa ttgatttcaa agagtctgaa gctcttccag ccctcgacga       480
     gcttttaaac aataaagtga atgagggtgg attcgmctyc gcatttgtgg atgcagacaa       540
     gctgaattat tggaactatc atgagaggct tattagattg atcaaagttg gtgggatcat       600
     agtgtatgat aacactctct ggggaggatc agttgctgaa ccggactcgt ccacgcccga       660
     gtggaggata gaagtcaaga aagcaaccct cgagctgaac aagaaactct cggctgatca       720
     gcgtgtgcag atctcgcaag ctgcgcttgg cgatggtatc actatttgca ggaggttata       780
     ttgagcgagt attgttgttc tttgtgatct ttagggtcat atgattgtga gccctttata       840
     ttgagctmtt gygatgcaag agtgttattg ttctatgtga tattttggtt cctgtgtgaa       900
     tgtgaacctt ttctatc                                                      917
//

If you have problems or comments...

PBIL Back to PBIL home page