(data stored in SCRATCH zone)

EMBL: AY090267

ID   AY090267; SV 1; linear; mRNA; STD; PLN; 1470 BP.
XX
AC   AY090267;
XX
DT   25-MAR-2002 (Rel. 71, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana AT4g26270/T25K17_80 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1470
RA   Kim C.J., Chen H., Cheuk R., Meyers M.C., Shinn P., Banh J., Bowser L.,
RA   Carninci P., Chang E., Dale J.M., Goldsmith A.D., Hayashizaki Y.,
RA   Ishida J., Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B.,
RA   Lee J.M., Lin J., Miranda M., Narusaka M., Nguyen M., Onodera C.S.,
RA   Palm C.J., Quach H.L., Sakurai T., Satou M., Seki M., Southwick A.,
RA   Tang C.C., Toriumi M., Wu H.C., Yamada K., Yamamura Y., Yu G., Yu S.,
RA   Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1470
RA   Kim C.J., Chen H., Cheuk R., Meyers M.C., Shinn P., Banh J., Bowser L.,
RA   Carninci P., Chang E., Dale J.M., Goldsmith A.D., Hayashizaki Y.,
RA   Ishida J., Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B.,
RA   Lee J.M., Lin J., Miranda M., Narusaka M., Nguyen M., Onodera C.S.,
RA   Palm C.J., Quach H.L., Sakurai T., Satou M., Seki M., Southwick A.,
RA   Tang C.C., Toriumi M., Wu H.C., Yamada K., Yamamura Y., Yu G., Yu S.,
RA   Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   ;
RL   Submitted (14-MAR-2002) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; ed7fc88f0b4b141a537a41edeb1e0b23.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Kim,C.J., Chen,H.,
CC   Cheuk,R., Meyers,M.C., Shinn,P., Banh,J. Bowser,L., Chang,E.,
CC   Dale,J.M., Goldsmith,A.D., Jones,T., Karlin-Neumann,G., Lam,B.,
CC   Lee,J.M., Lin,J., Miranda,M., Nguyen,M., Onodera,C.S., Palm,C.J.,
CC   Quach,H.L., Southwick,A., Tang,C.C., Toriumi,M., Wu,H.C.,
CC   Yamada,K., Yamamura, Y., Yu,G., Yu,S., Davis,R.W.,  Theologis,A.,
CC   and Ecker,J.R.
CC   Kim,C.J. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
CC   contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1470
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="U13212"
FT                   /note="This clone is in pUNI 51 ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..1470
FT                   /codon_start=1
FT                   /product="AT4g26270/T25K17_80"
FT                   /note="pyrophosphate-dependent phosphofructo-1-kinase"
FT                   /db_xref="GOA:Q94AA4"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012004"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q94AA4"
FT                   /protein_id="AAL90928.1"
FT                   /translation="MSTVESSKPKIINGSCGYVLEDVPHLSDYLPGLPTYPNPLQDNPA
FT                   YSVVKQYFVDADDSVPQKIVVHKDGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCP
FT                   GLNTVIREIVSSLSYMYGVKRILGIDGGYRGFYAKNTVSLDSKVVNDIHKRGGTILGTS
FT                   RGGHDTTKIVDSIQDRGINQVYIIGGDGTQRGASVIFEEIRRRGLKVAVIGIPKTIDND
FT                   IPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMYATLASRDV
FT                   DCCLIPESPFYLEGEGGLFEYIEKRLKESGHMVLVIAEGAGQDLMSKSMESMTLKDASG
FT                   NKLLKDVGLWLSQSIKDHFNQKKMVMNLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVH
FT                   GAMAGYTGYISGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPSFLGPKDVF
FT                   DNKEKPMSALLDDGNCNGVVDVPPVTKEITK"
XX
SQ   Sequence 1470 BP; 434 A; 279 C; 373 G; 384 T; 0 other;
     atgagtactg tggagagtag caaaccgaag atcatcaatg gctcttgtgg ttatgttcta        60
     gaagatgtac cgcatctctc cgattacctt cctggtcttc ctacttatcc taatccattg       120
     caagacaatc cagcttactc agtggttaag caatactttg ttgatgctga tgacagtgtt       180
     cctcaaaaga tcgttgttca caaggatggt ccaaggggga ttcattttag acgagccggg       240
     ccacgtcaga aggtatactt cgaatctgat gaagtgcatg cttgcatagt tacctgtgga       300
     ggtctttgtc ctggccttaa taccgtgatt agagaaatag tgagcagtct atcttatatg       360
     tatggagtga agagaatact gggaatagat ggtggatata gaggctttta tgctaagaat       420
     actgtctcct tggactctaa agttgtaaat gatatccata agcgtggagg gactatcctt       480
     gggacctcac gaggtggtca cgataccaca aagatagttg acagcattca agatcgagga       540
     atcaatcagg tttacattat aggaggagat ggaacacagc gaggagcatc tgtcatattt       600
     gaggaaatta gaagacgtgg cctgaaagtt gcagttattg gaatcccgaa aacaatcgat       660
     aatgacatac ctgtgataga caaatctttt gggtttgaca ctgctgtaga agaggctcaa       720
     cgagctatta atgcagcaca tgtggaagcc gagagtatag agaatggtat cggagttgtc       780
     aagcttatgg gtcgctacag cgggttcata gcgatgtatg ccactctagc aagcagagat       840
     gtggactgct gtttgattcc ggagtcacca ttttacctgg aaggagaagg cggactgttt       900
     gagtacatag agaaacgact caaggagagc ggtcacatgg ttcttgtgat tgcagaaggt       960
     gcaggacaag atctaatgtc gaagagcatg gaatctatga cactcaaaga tgcatctggt      1020
     aacaaacttc ttaaagatgt tggcctttgg ctgtcacaaa gcatcaagga tcattttaat      1080
     cagaagaaga tggtgatgaa cctcaagtac atagatccaa catacatgat tcgagctgtt      1140
     cctagcaatg cgtcagacaa tgtttattgt acacttctgg ctcagagtgc agtgcacggt      1200
     gcaatggctg gatacactgg ctatatcagt ggtctagtga acggaagaca aacctacata      1260
     cccttttaca ggataacgga gaaacagaac catgtggtga tcacagacag gatgtgggca      1320
     aggctactct cttcgacaaa ccagccgagt ttcttgggcc ccaaagatgt ctttgataat      1380
     aaagagaaac cgatgtcggc tctccttgac gatggtaact gcaatggcgt ggtggatgtt      1440
     cctccagtca ccaaagagat caccaagtga                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page