(data stored in SCRATCH zone)

EMBL: AY090321

ID   AY090321; SV 1; linear; mRNA; STD; PLN; 1428 BP.
XX
AC   AY090321;
XX
DT   25-MAR-2002 (Rel. 71, Created)
DT   25-MAR-2002 (Rel. 71, Last updated, Version 1)
XX
DE   Arabidopsis thaliana AT5g01210/F7J8_190 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1428
RA   Cheuk R., Chen H., Kim C.J., Meyers M.C., Shinn P., Banh J., Bowser L.,
RA   Carninci P., Chang E., Dale J.M., Goldsmith A.D., Hayashizaki Y.,
RA   Ishida J., Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B.,
RA   Lee J.M., Lin J., Miranda M., Narusaka M., Nguyen M., Onodera C.S.,
RA   Palm C.J., Quach H.L., Sakurai T., Satou M., Seki M., Southwick A.,
RA   Tang C.C., Toriumi M., Wu H.C., Yamada K., Yamamura Y., Yu G., Yu S.,
RA   Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1428
RA   Cheuk R., Chen H., Kim C.J., Meyers M.C., Shinn P., Banh J., Bowser L.,
RA   Carninci P., Chang E., Dale J.M., Goldsmith A.D., Hayashizaki Y.,
RA   Ishida J., Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B.,
RA   Lee J.M., Lin J., Miranda M., Narusaka M., Nguyen M., Onodera C.S.,
RA   Palm C.J., Quach H.L., Sakurai T., Satou M., Seki M., Southwick A.,
RA   Tang C.C., Toriumi M., Wu H.C., Yamada K., Yamamura Y., Yu G., Yu S.,
RA   Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   ;
RL   Submitted (14-MAR-2002) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 50ccbc83104b399f3c5413e42ede7947.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Cheuk,R., Chen,H.,
CC   Kim,C.J., Meyers,M.C., Shinn,P., Banh,J. Bowser,L., Chan,M.M.,
CC   Chang,E., Dale,J.M., Deng, J.M., Goldsmith,A.D., Jones,T.,
CC   Karlin-Neumann,G., Lam,B., Lee,J.M., Lin,J., Miranda,M., Nguyen,M.,
CC   Onodera,C.S., Palm,C.J., Quach,H.L., Southwick,A., Tang,C.C.,
CC   Toriumi,M., Wu,H.C., Yamada,K., Yamamura, Y., Yu,G., Davis,R.W.,
CC   Theologis,A., and Ecker,J.R.
CC   Cheuk,R. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
CC   contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1428
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /clone="U14297"
FT                   /note="This clone is in pUNI 51 ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..1428
FT                   /codon_start=1
FT                   /product="AT5g01210/F7J8_190"
FT                   /note="anthranilate N-benzoyltransferase-like protein"
FT                   /db_xref="GOA:Q9LFB5"
FT                   /db_xref="InterPro:IPR003480"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB5"
FT                   /protein_id="AAL90982.1"
FT                   /translation="MPSCSVTEISKCIVYPEKKSTVSDLRLSVSDLPMLSCHYIQKGVL
FT                   LTSPPPSFSFDDLVSSLRRSLSSTLSLFPALAGRFSTTPAGHISIVCNDAGVDFVAASA
FT                   KHVKLSDVLLPGEDVPLLFREFFVFERLVSYNGHHKPLAAVQVTELHDGVFIGCTVNHS
FT                   VTDGTSFWHFFNTFADVTSGACKIKHLPDFSRHTVFDSPVVLPVPPGGPRVTFDADQPL
FT                   RERIFHFSREAITKLKQRTNNRVNGIETAVNDGRKCNGEINGKITTVLDSFLNNKKSYD
FT                   RTAEISSFQSLSAQLWRSVTRARNLDPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSI
FT                   PTLASAGDLLSKDLRWSAEQLHRNVVAHDDATVRRGIAAWESDPRLFPLGNPDGASITM
FT                   GSSPRFPMYDNDFGWGKPLAVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMTGI
FT                   ENDAEFMQYVSEVTYDC"
XX
SQ   Sequence 1428 BP; 327 A; 391 C; 345 G; 365 T; 0 other;
     atgccttctt gttcggtaac tgaaatttca aaatgtatcg tctatccgga gaagaagtcc        60
     accgtctccg atctccgtct ctccgtctcc gacctcccta tgctctcatg tcattacatt       120
     caaaaaggcg tcctcctcac cagccctcct ccttccttct ccttcgacga ccttgtctcc       180
     tctctccgcc gttctctctc ctccactctt tccctcttcc ctgctttagc cggccgtttc       240
     tccaccactc ccgccggtca catttccatt gtctgcaacg acgccggagt tgatttcgtc       300
     gccgcttccg ctaaacacgt caaactctct gatgttctct taccaggtga agacgttcct       360
     ctgcttttcc gtgagttttt cgtcttcgag cgtctcgtta gttacaacgg tcatcataag       420
     cctctcgccg ccgttcaagt gacggagctc cacgacggtg tcttcatcgg atgtaccgtg       480
     aatcattccg ttactgacgg aacttccttc tggcacttct tcaacacctt tgctgacgtc       540
     actagcggtg cttgtaagat caaacacctt ccagatttct cccgccacac cgtcttcgat       600
     tctccggtcg ttcttccagt ccctcccggt ggtccacgtg tcactttcga cgccgaccaa       660
     cctctacggg agagaatttt tcatttcagc agagaggcga ttaccaaact gaaacagagg       720
     acgaataaca gagttaacgg aattgagact gccgttaacg atggaaggaa atgtaacgga       780
     gagattaacg gaaaaataac aaccgttttg gatagttttt tgaataataa gaagagttat       840
     gatcggacgg ctgagatttc atcgttccaa tctctcagcg ctcagctatg gcgatccgtt       900
     acacgagcga ggaatctcga tccgagcaag acgacgacgt ttcgaatggc ggttaattgc       960
     cggcaccggc ttgagccgaa gatggatccg tactacttcg gaaacgcgat acagagcata      1020
     ccgacgttgg cgtctgcggg agatctgcta agcaaagatc tcaggtggtc cgccgaacag      1080
     ttacacagga acgtggtggc gcacgacgac gcgacggtcc gccgtggaat cgccgcttgg      1140
     gaaagcgatc cgaggctgtt tcctctcgga aatccagatg gagcttcgat cacgatgggg      1200
     agctcgccga gattcccaat gtacgacaat gatttcggat ggggaaaacc gttagctgtg      1260
     agaagcggcg gagcgaataa attcgacggg aagatctcgg cgtttcccgg tagagaagga      1320
     aacggaagcg tggatctgga agtagttctg gcgccggaga ctatgactgg gattgagaac      1380
     gatgctgagt ttatgcaata cgtatcagaa gtcacttacg attgttga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page