(data stored in ACNUC7820 zone)

EMBL: AY096302

ID   AY096302; SV 1; linear; genomic DNA; STD; MUS; 384 BP.
XX
AC   AY096302;
XX
DT   27-MAY-2002 (Rel. 71, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor GA_x5J8B7TWBT8-615-998 gene, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-384
RA   Adams M.D.;
RT   ;
RL   Submitted (15-APR-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 646a2b1e82cfc9609356fc8ba250d686.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..384
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        1..>384
FT                   /codon_start=1
FT                   /product="olfactory receptor GA_x5J8B7TWBT8-615-998"
FT                   /db_xref="GOA:Q8K548"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K548"
FT                   /protein_id="AAM26945.1"
FT                   /translation="MTPRNMTTMSGFLLMGFSDNHELQILQALLFLLTYLLGSAGNFII
FT                   ITITTLDPQLQSPMYYFLKHLSILDLSSLSVTVPQYVDSSLARSGYISYGQCMLQIFFF
FT                   TGLAWSEVALLTVMSYDRYGPLPP"
XX
SQ   Sequence 384 BP; 84 A; 108 C; 79 G; 113 T; 0 other;
     atgactccaa gaaacatgac aacaatgagt ggattcctcc tcatggggtt ctctgacaac        60
     catgagctgc agatcttaca ggctttgctg tttttgctga catacctatt gggctcagca       120
     gggaacttca tcattatcac catcacaaca ctggacccac agctccagtc tccaatgtat       180
     tactttctga agcacctttc cattctggac ctctcatccc tctctgtcac agtcccccag       240
     tatgttgaca gttccctggc acgaagtggc tacatttcat atgggcagtg catgctgcag       300
     atatttttct tcacaggttt ggcctggagt gaggtggccc ttcttacagt gatgtcttat       360
     gaccgctatg ggcctctgcc tccc                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page