(data stored in ACNUC7820 zone)

EMBL: AY096332

ID   AY096332; SV 1; linear; genomic DNA; STD; MUS; 422 BP.
XX
AC   AY096332;
XX
DT   27-MAY-2002 (Rel. 71, Created)
DT   02-SEP-2002 (Rel. 72, Last updated, Version 2)
XX
DE   Mus musculus olfactory receptor GA_x5J8B7W5KGR-591839-591418 gene, partial
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-422
RA   Adams M.D.;
RT   ;
RL   Submitted (15-APR-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 1b3f70628f48c028f5ce24ca0072fde0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..422
FT                   /organism="Mus musculus"
FT                   /chromosome="17"
FT                   /map="17C"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..>422
FT                   /codon_start=1
FT                   /product="olfactory receptor GA_x5J8B7W5KGR-591839-591418"
FT                   /db_xref="GOA:Q8K519"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K519"
FT                   /protein_id="AAM26975.1"
FT                   /translation="XCGDKIIHQFFCDIPQLLKLSCSNDDFGVLKVSTFIAVMGFACFM
FT                   GIAFSYGQIFSTVLRMPSAEGRSKVFSTCLPHLFVVSFFLSTGICAYLKPTSDSPTTLD
FT                   FMLSIFYTVLPPTLNPVIYSLRNQSLKRAIKKLLLS"
XX
SQ   Sequence 422 BP; 99 A; 110 C; 71 G; 139 T; 3 other;
     nnntgtgggg acaaaattat tcaccagttc ttctgtgata tcccgcaatt gctcaagctc        60
     tcctgctcta atgatgactt tggagtactg aaagtgtcta ctttcattgc tgtaatggga       120
     tttgcctgct ttatggggat tgccttctcc tatggccaaa tattctctac agttctcagg       180
     atgccctctg ctgaaggccg atctaaggtc ttctccacct gcctgcccca tcttttcgtt       240
     gtttcatttt ttctctcaac aggcatttgt gcctatctaa agccaacctc agactcacca       300
     actactttag acttcatgct ctctatcttt tacacagtac tacccccaac cctcaaccct       360
     gttatctata gtctgagaaa ccagtccttg aaaagagcta taaagaagtt actgttaagt       420
     ga                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page