(data stored in ACNUC7820 zone)

EMBL: AY096347

ID   AY096347; SV 1; linear; genomic DNA; STD; MUS; 333 BP.
XX
AC   AY096347;
XX
DT   27-MAY-2002 (Rel. 71, Created)
DT   02-SEP-2002 (Rel. 72, Last updated, Version 2)
XX
DE   Mus musculus olfactory receptor GA_x5J8B7W6RL5-13522154-13521822 gene,
DE   partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-333
RA   Adams M.D.;
RT   ;
RL   Submitted (15-APR-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; d1fbe4dd9addbf04662ebe6d944d8198.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..333
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /map="9A2-9A5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..333
FT                   /codon_start=1
FT                   /product="olfactory receptor
FT                   GA_x5J8B7W6RL5-13522154-13521822"
FT                   /db_xref="GOA:Q8K504"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K504"
FT                   /protein_id="AAM26990.1"
FT                   /translation="AFMFGGIPFFGIFLSYTEIVSSVLKIPSRQGRYKAFSTCGSHLSV
FT                   VSLFYGTGLGVYISSAVTESPRKTAVASVMYSIVTQMLNPFIYSLRNRDMKEALRKHVG
FT                   RIASIV"
XX
SQ   Sequence 333 BP; 86 A; 64 C; 71 G; 112 T; 0 other;
     gctttcatgt ttggtggtat tcctttcttt ggaatatttc tttcttatac tgaaattgtc        60
     tcctctgttt tgaaaattcc atcaaggcaa ggaagatata aagcattttc cacgtgtggc       120
     tctcacctgt cagtagtttc cttgttttat gggacaggct taggagtgta cattagctct       180
     gcagttactg aatctcccag gaagacagca gttgcttcag taatgtactc tattgtcact       240
     cagatgctga acccttttat ctacagcctg aggaacagag acatgaagga agctttaagg       300
     aagcacgttg gaaggatagc ttccattgta taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page