(data stored in ACNUC16935 zone)

EMBL: AY098958

ID   AY098958; SV 1; linear; mRNA; STD; PLN; 690 BP.
XX
AC   AY098958;
XX
DT   07-MAY-2002 (Rel. 71, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana AT4g05050/T32N4_13 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-690
RA   Kim C.J., Chen H., Cheuk R., Meyers M.C., Shinn P., Banh J., Bowser L.,
RA   Carninci P., Chang E., Dale J.M., Goldsmith A.D., Hayashizaki Y.,
RA   Ishida J., Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B.,
RA   Lee J.M., Lin J., Miranda M., Narusaka M., Nguyen M., Onodera C.S.,
RA   Palm C.J., Quach H.L., Sakurai T., Satou M., Seki M., Southwick A.,
RA   Tang C.C., Toriumi M., Wu H.C., Yamada K., Yamamura Y., Yu G., Yu S.,
RA   Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-690
RA   Kim C.J., Chen H., Cheuk R., Meyers M.C., Shinn P., Banh J., Bowser L.,
RA   Carninci P., Chang E., Dale J.M., Goldsmith A.D., Hayashizaki Y.,
RA   Ishida J., Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B.,
RA   Lee J.M., Lin J., Miranda M., Narusaka M., Nguyen M., Onodera C.S.,
RA   Palm C.J., Quach H.L., Sakurai T., Satou M., Seki M., Southwick A.,
RA   Tang C.C., Toriumi M., Wu H.C., Yamada K., Yamamura Y., Yu G., Yu S.,
RA   Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   ;
RL   Submitted (22-APR-2002) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 8fc5cb0ac1139007f92f8de85e518a80.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Kim,C.J., Chen,H.,
CC   Cheuk,R., Meyers,M.C., Shinn,P., Banh,J. Bowser,L., Chang,E.,
CC   Dale,J.M., Goldsmith,A.D., Jones,T., Karlin-Neumann,G., Lam,B.,
CC   Lee,J.M., Lin,J., Miranda,M., Nguyen,M., Onodera,C.S., Palm,C.J.,
CC   Quach,H.L., Southwick,A., Tang,C.C., Toriumi,M., Wu,H.C.,
CC   Yamada,K., Yamamura, Y., Yu,G., Yu,S., Davis,R.W.,  Theologis,A.,
CC   and Ecker,J.R.
CC   Kim,C.J. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
CC   contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..690
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="U13740"
FT                   /note="This clone is in pUNI 51 ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..690
FT                   /codon_start=1
FT                   /product="AT4g05050/T32N4_13"
FT                   /note="putative polyubiquitin"
FT                   /db_xref="GOA:P0CH33"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CH33"
FT                   /protein_id="AAM19968.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
FT                   LRLRGGF"
XX
SQ   Sequence 690 BP; 184 A; 169 C; 180 G; 157 T; 0 other;
     atgcagatct tcgttaagac tctcaccgga aagactatca ccctcgaggt ggaaagctct        60
     gacaccatcg acaacgttaa ggccaagatc caggataagg aaggtattcc tccggatcag       120
     cagaggctta tcttcgccgg aaagcagttg gaggatggcc gcacgttggc ggattacaat       180
     atccagaagg aatccaccct ccacttggtt ctcaggctcc gtggtggtat gcagattttc       240
     gttaaaaccc taacgggaaa gacgattact cttgaggtgg agagctctga caccattgac       300
     aacgtcaagg ccaagatcca agataaggag ggtattcctc cggaccagca gaggttgatc       360
     ttcgccggaa agcaacttga ggacggcaga actttggcgg attacaacat ccagaaggag       420
     tctacgcttc atttggtctt gcgtctgcgt ggaggtatgc agatcttcgt aaagactttg       480
     accggaaaga ccatcactct tgaagttgag agctccgaca ccattgataa cgtgaaggct       540
     aagatccagg acaaggaagg cattcctccg gaccagcagc gtctcatctt cgctggaaag       600
     cagcttgagg atggacgtac tttggccgac tacaacatcc agaaggagtc tactcttcac       660
     ttggtcctcc gtctccgtgg tggtttctaa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page