(data stored in ACNUC27637 zone)

EMBL: AY099530

ID   AY099530; SV 1; linear; mRNA; STD; VRT; 729 BP.
XX
AC   AY099530;
XX
DT   26-MAY-2002 (Rel. 71, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Danio rerio nuclear cap binding protein subunit 2 (ncbp2) mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-729
RX   DOI; 10.1038/ng896.
RX   PUBMED; 12006978.
RA   Golling G., Amsterdam A., Sun Z., Antonelli M., Maldonado E., Chen W.,
RA   Burgess S., Haldi M., Artzt K., Farrington S., Lin S.-Y., Nissen R.M.,
RA   Hopkins N.;
RT   "Insertional mutagenesis in zebrafish rapidly identifies genes essential
RT   for early vertebrate development";
RL   Nat Genet 31(2):135-140(2002).
XX
RN   [2]
RP   1-729
RA   Amsterdam A., Golling G., Hopkins N.;
RT   ;
RL   Submitted (24-APR-2002) to the INSDC.
RL   Center for Cancer Research, Massachusetts Institute of Technology, 77
RL   Massachusetts Ave, Cambridge, MA 02139, USA
XX
DR   MD5; 175bc3157362006711c03762409ed551.
DR   Ensembl-Gn; ENSDARG00000014898; danio_rerio.
DR   Ensembl-Tr; ENSDART00000008365; danio_rerio.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..729
FT                   /organism="Danio rerio"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7955"
FT   CDS_pept        61..528
FT                   /codon_start=1
FT                   /gene="ncbp2"
FT                   /product="nuclear cap binding protein subunit 2"
FT                   /db_xref="GOA:Q8JGR6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR027157"
FT                   /db_xref="InterPro:IPR034148"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8JGR6"
FT                   /db_xref="ZFIN:ZDB-GENE-020419-31"
FT                   /protein_id="AAM28218.1"
FT                   /translation="MSIKLNALFSDFYVDVSQYRDQHFKGNRYEQEKLLKQSATLYVGN
FT                   LSFYTTEEQVHVLFAKCGDVKRIIIGLDKIKKTACGFCFVEYYTRADAENAMRFVNGTR
FT                   LDDRIIRTDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKMVQKS"
XX
SQ   Sequence 729 BP; 199 A; 154 C; 174 G; 202 T; 0 other;
     gtcgtgctga tttaaacgcg tccagcttca cttttcctca attaatttgc ttttttcaca        60
     atgtccataa agttaaatgc tcttttcagc gacttctatg ttgatgtgag ccagtacagg       120
     gatcagcatt ttaagggcaa ccgttacgag caggagaagc tcctcaaaca gagcgccacg       180
     ctgtatgtag gaaacctgtc cttctacacc acagaggagc aggtgcatgt gctcttcgcc       240
     aagtgtggag acgtcaagag gatcatcatc ggcctcgaca aaatcaagaa gactgcgtgc       300
     ggcttctgct tcgtcgaata ttacactcgt gcggacgctg agaacgccat gaggtttgtc       360
     aacggcacgc gtcttgacga ccgcatcatc agaacagact gggacgcagg cttcaaagag       420
     ggccgacagt acggacgggg gaaatctggt ggtcaggtca gagatgaata caggcaggac       480
     tatgatcccg ccagaggggg ttatgggaag atggtgcaga aatcttgaac atccctttcg       540
     tcattttcct tttctttttt tttaatcttt taaaatattt ccacgttatg aatgaatctg       600
     gcaggattac ggctgttttc tgaatgtaca tatcggagtt tgctttagga atcgctcaag       660
     ttcttctggt ccagcatgat gagtttaata aattgtgttt tgtttcccaa aaaaaaaaaa       720
     aaaaaaaaa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page