(data stored in SCRATCH zone)

EMBL: AY128848

ID   AY128848; SV 1; linear; mRNA; STD; PLN; 632 BP.
XX
AC   AY128848;
XX
DT   12-AUG-2002 (Rel. 72, Created)
DT   12-AUG-2002 (Rel. 72, Last updated, Version 1)
XX
DE   Arabidopsis thaliana unknown protein (At4g26240) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-632
RA   Tripp M., Southwick A., Karlin-Neumann G., Nguyen M., Miranda M.,
RA   Palm C.J., Bowser L., Jones T., Banh J., Carninci P., Chen H., Cheuk R.,
RA   Chung M.K., Hayashizaki Y., Ishida J., Kamiya A., Kawai J., Kim C., Lin J.,
RA   Liu S.X., Narusaka M., Pham P.K., Sakano H., Sakurai T., Satou M., Seki M.,
RA   Shinn P., Yamada K., Shinozaki K., Ecker J., Theologis A., Davis R.W.;
RT   ;
RL   Submitted (01-JUL-2002) to the INSDC.
RL   DNA Sequencing and Technology Center, Stanford University, 855 California
RL   Avenue, Palo Alto, CA 94304, USA
XX
DR   MD5; 8d0e7a46b5ce63b577d7932f74bd350a.
XX
CC   e-mail for correspondence: arab@sequence.stanford.edu
CC   The RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length  cDNA'): Seki,M., Narusaka,M.,  Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai, J.,
CC   Hayashizaki,Y.  and  Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members constructed and
CC   sequenced the pUNI (ORF) clones using the RAFL cDNAs: Tripp,M.,
CC   Nguyen,M., Southwick,A., Karlin-Neumann,G.,  Lam,B., Miranda,M.,
CC   Palm,C.J., Bowser,L., Jones,T., Banh,J., Chen,H., Cheuk,R.,
CC   Chung,M.K., Kim,C., Lin,J., Liu,S.X., Pham,P.K., Sakano,H.,
CC   Shinn,P., Yamada,K., Ecker,J., Theologis,A. and Davis,R.W.
CC   Tripp,M, (SSP/Stanford) and Seki,M. (RIKEN GSC) contributed equally
CC   to this work.  Shinozaki,K. (RIKEN GSC) and Davis,R.W.
CC   (SSP/Stanford)  contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..632
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="U24659"
FT                   /note="This clone is in pENTR/SD-dTopo   This is a cloned
FT                   PCR product using RIKEN clone RAFL09-66-D16 (AY081357) as a
FT                   template ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..597
FT                   /codon_start=1
FT                   /gene="At4g26240"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:Q8RXC0"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RXC0"
FT                   /protein_id="AAM91248.1"
FT                   /translation="MKKLARKWRRTRRDEDDDKFVLPTSEDVDSRPIDTQEQEEYVRYL
FT                   EEAHAQQSLQWRSVFVVLLICFGAFLFYSIFQQFMSPWELRYHAYFMEDLKSWMVISAE
FT                   WIAIMACSLSIVGLRDKKNDHRRWFWYSCVVGSALTIFWLYYLLRLPKFRWDAIWLPFG
FT                   PLCGAGICLYVDHLLEESSEEVKKLRNYMYAYKAR"
XX
SQ   Sequence 632 BP; 151 A; 125 C; 164 G; 192 T; 0 other;
     atgaagaagt tagcgagaaa atggcggaga actcgtcgtg acgaagatga tgataagttc        60
     gtccttccta cttctgaaga cgtcgattct cggcctattg atacgcaaga gcaggaggag       120
     tacgttcggt atcttgagga agctcatgct cagcaaagtc ttcaatggag gagcgtgttt       180
     gtggttcttc tgatctgctt tggagctttc ctcttctact ccattttcca gcagttcatg       240
     tcaccatggg aactgcggta tcatgcctac tttatggaag atctcaagtc atggatggtc       300
     atttcagctg agtggatcgc tatcatggct tgctccctct ccattgtcgg gctacgagat       360
     aagaagaatg atcatagacg atggttctgg tactcttgtg ttgttggatc tgcattgacc       420
     atcttttggc tttattactt gctgaggctt ccgaaattcc ggtgggatgc tatctggctt       480
     ccgtttgggc cgctttgtgg agctggaatt tgtctatacg tggaccatct tctagaggag       540
     tcatctgagg aagtgaaaaa actgaggaac tatatgtatg catataaagc acggtagaga       600
     gataatagct actttcaaac ctcgtcagag tg                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page