(data stored in ACNUC8465 zone)

EMBL: AY129469

ID   AY129469; SV 1; linear; mRNA; STD; PLN; 1101 BP.
XX
AC   AY129469;
XX
DT   12-AUG-2002 (Rel. 72, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana At1g51660/F19C24_26 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1101
RA   Shinn P., Chen H., Cheuk R., Kim C.J., Banh J., Bowser L., Carninci P.,
RA   Chang E., Dale J.M., Goldsmith A.D., Hayashizaki Y., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Lam B., Lee J.M., Lin J.,
RA   Miranda M., Narusaka M., Nguyen M., Onodera C.S., Palm C.J., Quach H.L.,
RA   Sakurai T., Satou M., Seki M., Southwick A., Tang C.C., Toriumi M.,
RA   Wu H.C., Yamada K., Yamamura Y., Yu G., Yu S., Shinozaki K., Davis R.W.,
RA   Theologis A., Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1101
RA   Shinn P., Chen H., Cheuk R., Kim C.J., Banh J., Bowser L., Carninci P.,
RA   Chang E., Dale J.M., Goldsmith A.D., Hayashizaki Y., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Lam B., Lee J.M., Lin J.,
RA   Miranda M., Narusaka M., Nguyen M., Onodera C.S., Palm C.J., Quach H.L.,
RA   Sakurai T., Satou M., Seki M., Southwick A., Tang C.C., Toriumi M.,
RA   Wu H.C., Yamada K., Yamamura Y., Yu G., Yu S., Shinozaki K., Davis R.W.,
RA   Theologis A., Ecker J.R.;
RT   ;
RL   Submitted (05-JUL-2002) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 6b50733d62eaae3a7d2aa058e0a9306b.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Shinn,P., Chen,H.,
CC   Cheuk,R., Kim,C.J.,  Banh,J. Bowser,L., Chang,E., Dale,J.M.,
CC   Goldsmith,A.D., Jones,T., Karlin-Neumann,G., Lam,B., Lee,J.M.,
CC   Lin,J., Miranda,M., Nguyen,M., Onodera,C.S., Palm,C.J., Quach,H.L.,
CC   Southwick,A., Tang,C.C., Toriumi,M., Wu,H.C., Yamada,K., Yamamura,
CC   Y., Yu,G., Yu,S., Davis,R.W.,  Theologis,A., and Ecker,J.R.
CC   Shinn,P. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
CC   contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1101
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="1"
FT                   /mol_type="mRNA"
FT                   /clone="U12417"
FT                   /note="ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..1101
FT                   /codon_start=1
FT                   /product="At1g51660/F19C24_26"
FT                   /note="MAP kinase kinase 4 (ATMKK4)"
FT                   /db_xref="GOA:O80397"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:O80397"
FT                   /protein_id="AAM91055.1"
FT                   /translation="MRPIQSPPGVSVPVKSRPRRRPDLTLPLPQRDVSLAVPLPLPPTS
FT                   GGSGGSSGSAPSSGGSASSTNTNSSIEAKNYSDLVRGNRIGSGAGGTVYKVIHRPSSRL
FT                   YALKVIYGNHEETVRRQICREIEILRDVNHPNVVKCHEMFDQNGEIQVLLEFMDKGSLE
FT                   GAHVWKEQQLADLSRQILSGLAYLHSRHIVHRDIKPSNLLINSAKNVKIADFGVSRILA
FT                   QTMDPCNSSVGTIAYMSPERINTDLNQGKYDGYAGDIWSLGVSILEFYLGRFPFPVSRQ
FT                   GDWASLMCAICMSQPPEAPATASPEFRHFISCCLQREPGKRRSAMQLLQHPFILRASPS
FT                   QNRSPQNLHQLLPPPRPLSSSSSPTT"
XX
SQ   Sequence 1101 BP; 262 A; 242 C; 269 G; 328 T; 0 other;
     atgagaccga ttcaatcgcc tccaggagtt tccgttccgg tgaaaagccg tccccgtcgc        60
     cgtcctgatc ttaccttacc gcttcctcaa cgcgatgttt ctctcgctgt acctcttcct       120
     ctcccaccta cttccggtgg ttccggtggc tctagtggat ctgcgccgtc ttctggtggt       180
     tcggcgtctt caacgaacac taacagctcc atagaagcga agaactattc ggatttagtg       240
     agaggtaacc gtatcggaag cggagcaggt ggaacggtat acaaagtgat tcaccgtccg       300
     agttctcgtc tatatgcact taaggtgata tacggtaacc acgaggagac tgtgagacgt       360
     cagatctgta gagagatcga gattttacga gatgtgaatc atccaaacgt tgtgaaatgt       420
     cacgagatgt ttgatcagaa cggtgagatc caggttttgc ttgagtttat ggataaaggt       480
     tctttagaag gtgctcatgt gtggaaagag caacaattag ctgatctatc tcgtcagatt       540
     cttagtggtt tagcttatct ccatagccgt cacatagttc atcgtgatat caaaccatcg       600
     aatcttttga taaactctgc taaaaacgtt aagattgctg attttggagt tagtaggatc       660
     ttggctcaga ctatggatcc gtgtaattca tctgttggaa ccattgctta tatgagtcct       720
     gagaggatta acactgattt gaatcaggga aagtatgatg gttatgctgg agatatttgg       780
     agcttaggtg ttagcatttt ggagttttac ttggggaggt ttcctttccc tgtgagtaga       840
     caaggtgatt gggctagtct tatgtgtgcc atttgtatgt ctcagcctcc agaagctcca       900
     gcgactgcgt cgccggagtt tcggcatttt atctcgtgtt gcttgcagag agaaccgggg       960
     aaaaggagga gtgctatgca gctattgcag catcctttca tattaagagc aagtccgagc      1020
     cagaacaggt ctcctcagaa tctacatcaa ctcttgcctc ctcctcgtcc tctgtcctcg      1080
     tcttcttctc caaccacata g                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page