(data stored in ACNUC9543 zone)

EMBL: AY133872

ID   AY133872; SV 1; linear; mRNA; STD; PLN; 3166 BP.
XX
AC   AY133872;
XX
DT   12-AUG-2002 (Rel. 72, Created)
DT   20-SEP-2002 (Rel. 73, Last updated, Version 2)
XX
DE   Arabidopsis thaliana clone U09737 putative RNA helicase (At1g32490) mRNA,
DE   complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-3166
RA   Yamada K., Chan M.M., Chang C.H., Dale J.M., Deng J.M., Hsuan V.W.,
RA   Lee J.M., Quach H.L., Tang C., Toriumi M., Wallender E.K., Wong C.,
RA   Wu H.C., Yu G., Yuan S., Bowser L., Carninci P., Chen H., Cheuk R.,
RA   Hayashizaki Y., Ishida J., Jones T., Kamiya A., Karlin-Neumann G.,
RA   Kawai J., Kim C., Lam B., Lin J., Miranda M., Narusaka M., Nguyen M.,
RA   Palm C.J., Sakurai T., Satou M., Seki M., Shinn P., Southwick A.,
RA   Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   "Arabidopsis Open Reading Frame (ORF) Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-3166
RA   Yamada K., Chan M.M., Chang C.H., Dale J.M., Deng J.M., Hsuan V.W.,
RA   Lee J.M., Quach H.L., Tang C.C., Toriumi M., Wallender E.K., Wong C.,
RA   Wu H.C., Yu G., Yuan S., Bowser L., Carninci P., Chen H., Cheuk R.,
RA   Hayashizaki Y., Ishida J., Jones T., Kamiya A., Karlin-Neumann G.,
RA   Kawai J., Kim C., Lam B., Lin J., Miranda M., Narusaka M., Nguyen M.,
RA   Palm C.J., Sakurai T., Satou M., Seki M., Shinn P., Southwick A.,
RA   Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (17-JUL-2002) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; a1fc7f24823dd92b4bd201322ba1e174.
XX
CC   The RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length  cDNA'): Seki,M., Narusaka,M.,  Ishida,J.,
CC    Satou,M.,  Kamiya,A., Sakurai,T., Carninci,P.,  Kawai, J.,
CC   Hayashizaki,Y.  and  Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members constructed and
CC   sequenced the pUNI (ORF) clones using the RAFL cDNAs: Yamada,K.,
CC   Chan,M.M., Chang,C.H., Dale,J.M., Deng,J.M., Hsuan,V.W., Lee,J.M.,
CC   Quach,H.L., Tang,C.C., Toriumi,M., Wallender,E.K., Wong,C.,
CC   Wu,H.C., Yu,G., Yuan,S., Bowser,L., Chen,H., Cheuk,R., Jones,T.,
CC   Karlin-Neumann,G., Kim,C., Lam,B., Lin,J., Miranda,M., Nguyen,M.,
CC   Palm,C.J., Shinn,P., Southwick,A., Davis,R.W., Ecker,J.R. and
CC   Theologis,A.
CC   Yamada,K. (SSP/PGEC) and Seki, M. (RIKEN GSC) contributed equally
CC   to this work.  Shinozaki,K. (RIKEN GSC) and Theologis,A. (SSP
CC   /PGEC) contributed equally to this work as PIs.
CC   Annotation is based on the January 2002 version of the Arabidopsis
CC   genome submitted to GenBank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3166
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="1"
FT                   /mol_type="mRNA"
FT                   /clone="U09737"
FT                   /note="This clone is in pUNI 51. ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..3135
FT                   /codon_start=1
FT                   /gene="At1g32490"
FT                   /product="putative RNA helicase"
FT                   /db_xref="GOA:Q8VY00"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VY00"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAM91806.1"
FT                   /translation="MASNDLKTWVSDKLMMLLGYSQAAVVNYLIAMAKKTKSPTELVGE
FT                   LVDYGFSSSGDTRSFAEEIFARVPRKTAGVNLYQKHEAEAAMLVRKQKTYALLDADDDE
FT                   DEVVVEKKSSVSESRKSDKGKKRFRKKSGQSDESDGEVAVREDSRHVRRKVSEEDDGSE
FT                   SEEERVRDQKEREELEQHLKDRDTARTRKLTEQTLSKKEKEEAVRRANALEKDDLYSLR
FT                   KVSRQEYLKKREQKKLDELRDEIEDEQYLFGGEKLTETELREFRYKKELYDLVKKRTQD
FT                   EDNVEEYRIPDAYDQEGGVDQEKRFSVAVQRYRDLDSTEKMNPFAEQEAWEDHQIGKAT
FT                   LKFGAKNKQASDDYQFVFEDQINFIKESVMAGENYEDAMDAKQKSQDLAEKTALEELQE
FT                   VRRSLPIYTYRDQLLKAVEEHQVLVIVGDTGSGKTTQIPQYLHEAGYTKRGKVGCTQPR
FT                   RVAAMSVAARVAQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLRELLGEPDLAS
FT                   YSVVIVDEAHERTLSTDILFGLVKDIARFRPDLKLLISSATMDAEKFSDYFDTAPIFSF
FT                   PGRRYPVEINYTSAPEADYMDAAIVTILTIHVREPLGDILVFFTGQEEIETAEEILKHR
FT                   IRGLGTKIRELIICPIYANLPSELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVV
FT                   DPGFSKMKSYNPRTGMESLLITPISKASATQRAGRAGRTSPGKCYRLYTAFNYNNDLEE
FT                   NTVPEVQRTNLASVVLALKSLGIHDLINFDFMDPPPAEALVKSLELLFALGALNKLGEL
FT                   TKAGRRMAEFPLDPMLSKMIVVSDKYKCSDEIISIAAMLSIGGSIFYRPKDKQVHADNA
FT                   RMNFHTGNVGDHIALLKVYSSWKETNFSTQWCYENYIQVRSMKRARDIRDQLEGLLERV
FT                   EIDISSNLNELDSVRKSIVAGFFPHTAKLQKNGSYRTVKHPQTVHIHPNSGLSQVLPRW
FT                   VVYHELVLTSKEYMRQVTELKPEWLIELAPHYYQLKDVEDAASKKMPKGAGKAAM"
FT   3'UTR           3136..3166
FT                   /gene="At1g32490"
XX
SQ   Sequence 3166 BP; 1024 A; 555 C; 794 G; 793 T; 0 other;
     atggcgagca atgatttgaa gacttgggtt tcggataagc tgatgatgct acttggctac        60
     tctcaagcgg ctgttgttaa ctatctcatt gcaatggcta aaaaaacaaa atcaccaact       120
     gaacttgtgg gagagttggt ggattacggg ttttcgtctt ctggtgatac tcgttcgttt       180
     gcagaagaaa tttttgccag agttccccgt aaaactgctg gtgtaaatct ctaccaaaaa       240
     catgaagcag aggcagcaat gctagtgagg aagcagaaaa catatgctct tttagatgct       300
     gatgatgatg aagacgaagt tgttgtggag aaaaaatctt cagtttctga atctagaaaa       360
     tcagataagg gcaagaaaag gtttagaaag aaaagtgggc agtcagatga aagtgatggc       420
     gaggtggccg ttagagagga tagtagacac gttagaagaa aggtttctga agaggatgat       480
     ggttctgagt cagaagagga aagagtgcgt gaccaaaagg agagagaaga actggagcag       540
     catttaaaag atcgtgatac tgcacggaca cgaaagctaa cagagcaaac gttgtcaaag       600
     aaagagaaag aagaggctgt tcgaagagca aatgctttgg agaaggatga tttatattcc       660
     ttaaggaaag tctcgagaca agaatactta aagaagagag aacaaaagaa actggatgaa       720
     ctaagggatg agatagaaga tgaacaatat cttttcggag gtgaaaagct cacagaaacg       780
     gagcttcgtg agtttaggta caagaaagag ctttatgacc tcgtgaagaa aagaacacaa       840
     gatgaagata acgtcgagga gtatagaatt ccagatgctt atgatcaaga gggaggtgtt       900
     gatcaggaga agaggttttc tgttgctgtt caacgataca gggacctgga ttcaacagag       960
     aaaatgaatc cattcgcaga gcaagaagct tgggaggacc atcagattgg aaaagcaaca      1020
     ttaaaatttg gtgcaaagaa taagcaagcc tcagacgatt atcagtttgt gtttgaagac      1080
     caaataaact tcataaagga atctgtcatg gctggtgaaa attatgaaga tgctatggat      1140
     gcaaaacaaa aatctcaaga tttggcagag aaaacagctt tagaggaact tcaggaagtc      1200
     agaagaagtc tgccgattta tacgtatcgt gatcaactgc ttaaggctgt ggaagagcat      1260
     caggttcttg tcattgtggg agacactggt tcaggaaaaa cgacacaaat accacaatat      1320
     ctccatgaag ctggttacac aaagcgtgga aaggttggtt gtacgcagcc ccgaagagtt      1380
     gcagctatga gtgttgctgc ccgtgtggct caagagatgg gtgtcaaact cggacatgag      1440
     gttggctatt ccattcgatt tgaggattgt acttcagaca aaacagttct gaagtatatg      1500
     actgatggaa tgcttttgcg cgagctgctt ggtgagccag acctggccag ctacagtgtc      1560
     gttattgtgg atgaggcaca tgaaaggacc ttgtcaaccg atatactgtt tggattagtc      1620
     aaggatatag cgcggtttcg acctgatttg aagttgttga tatctagtgc aacaatggat      1680
     gcagaaaaat tttctgatta ttttgataca gccccgattt ttagttttcc tggaagaagg      1740
     tatccagttg aaatcaacta tacaagtgca cctgaagctg attacatgga cgcagccata      1800
     gttactatcc ttacgatcca tgtgagggag ccacttggag atatattggt cttcttcact      1860
     ggtcaagagg aaattgaaac tgcagaagag atcttgaagc acaggataag aggtttgggt      1920
     acaaagatcc gtgaattaat catatgccca atttacgcaa atcttccaag tgaactccaa      1980
     gcaaaaatat ttgagccaac tccagaaggg gcacgtaaag ttgtcctagc aacaaatatc      2040
     gccgaaacat cattgacaat tgatggtata aagtatgttg ttgatccagg ctttagcaag      2100
     atgaagtcat ataacccgag gacagggatg gaatctttgc ttattactcc tatctctaag      2160
     gcttctgcaa ctcaacgagc tggtcgtgct ggaagaacaa gtccagggaa gtgttatcgt      2220
     ctgtacactg cgtttaatta caacaatgac ttggaggaaa acacggtgcc agaagtacag      2280
     aggacgaatc ttgctagtgt ggtgcttgct ttgaagagtc ttggaattca tgatctcata      2340
     aacttcgatt tcatggaccc tccacctgct gaagcacttg taaagtcttt agaactgctc      2400
     tttgctctgg gtgctctaaa taagctcggg gaattgacta aagctggtag aaggatggca      2460
     gagttccccc ttgatccaat gctgtcgaaa atgattgttg tttctgacaa gtataagtgc      2520
     tccgatgaga taatatcaat cgctgctatg ttgtcaattg gtggctctat cttctaccgt      2580
     cccaaggaca aacaagttca tgcggacaac gcaagaatga atttccacac cgggaatgtc      2640
     ggtgaccata ttgctttgct aaaggtttac agttcatgga aggaaacaaa cttctctact      2700
     cagtggtgct acgagaacta cattcaggtc cggagcatga aaagagccag agatatccgt      2760
     gatcaattgg agggacttct cgaaagggtg gaaatagata tcagctcaaa cctgaatgaa      2820
     ttggattcag ttagaaaatc catcgtagcc gggttttttc cgcacactgc aaagctacag      2880
     aagaatggat cgtaccgaac agtgaaacat ccccagacag tgcacataca tcccaattcg      2940
     ggcttatctc aggtattgcc gagatgggtt gtatatcacg aactagtact tacgtccaag      3000
     gaatacatgc gacaggtaac agagttgaaa ccagagtggt tgattgagtt agctcctcac      3060
     tactaccagc tcaaggacgt tgaagacgct gcatcaaaga aaatgcccaa aggagctgga      3120
     aaagctgcaa tgtaagaact cagatgggat tggcaaaaga ataatg                     3166
//

If you have problems or comments...

PBIL Back to PBIL home page