(data stored in SCRATCH zone)

EMBL: AY140072

ID   AY140072; SV 1; linear; mRNA; STD; PLN; 1732 BP.
XX
AC   AY140072;
XX
DT   04-SEP-2002 (Rel. 73, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana protein kinase ATN1-like protein (At5g01850) mRNA,
DE   complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1732
RA   Tripp M., Southwick A., Karlin-Neumann G., Nguyen M., Miranda M.,
RA   Palm C.J., Bowser L., Jones T., Banh J., Carninci P., Chen H., Cheuk R.,
RA   Chung M.K., Hayashizaki Y., Ishida J., Kamiya A., Kawai J., Kim C., Lin J.,
RA   Liu S.X., Narusaka M., Pham P.K., Sakano H., Sakurai T., Satou M., Seki M.,
RA   Shinn P., Yamada K., Shinozaki K., Ecker J., Theologis A., Davis R.W.;
RT   ;
RL   Submitted (12-AUG-2002) to the INSDC.
RL   DNA Sequencing and Technology Center, Stanford University, 855 California
RL   Avenue, Palo Alto, CA 94304, USA
XX
DR   MD5; face951ad1dcb8446096a4e89a66afac.
XX
CC   e-mail for correspondence: arab@sequence.stanford.edu
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Sh inozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Tripp,M.,
CC   Southwick,A., Nguyen,M., Palm,C.J., Jones,T., Wu,T., Chen,H.,
CC   Cheuk,R., Chan,M.M., Chang,C.H., Dale,J.M., Deng,J.M., Hsuan,V.W.,
CC   Lee,J.M., Kim,C.J., Quach,H.L., Shinn,P., Tang,C.C., Toroumi,M.,
CC   Wallender,E.K., Wong,C., Wu,H.C., Yamada,K., Yu,G., Yuan,S.,
CC   Ecker,J., Theologis,A. and Davis,R.W.
CC   Tripp,M. (SSP/Stanford) and Seki,M. (RIKEN GSC) contributed equally
CC   to this work.  Shinozaki,K. (RIKEN GSC) and Davis,R.W.
CC   (SSP/Stanford) contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1732
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL09-67-A02 (R24815)"
FT                   /note="This clone is in pBluescript ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        447..1448
FT                   /codon_start=1
FT                   /gene="At5g01850"
FT                   /product="protein kinase ATN1-like protein"
FT                   /db_xref="GOA:Q8L6Y9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q8L6Y9"
FT                   /protein_id="AAM98213.1"
FT                   /translation="MSSDDTIEESLLVDPKLLFIGSKIGEGAHGKVYQGRYGRQIVAIK
FT                   VVNRGSKPDQQSSLESRFVREVNMMSRVQHHNLVKFIGACKDPLMVIVTELLPGMSLRK
FT                   YLTSIRPQLLHLPLALSFALDIARALHCLHANGIIHRDLKPDNLLLTENHKSVKLADFG
FT                   LAREESVTEMMTAETGTYRWMAPELYSTVTLRQGEKKHYNNKVDVYSFGIVLWELLTNR
FT                   MPFEGMSNLQAAYAAAFKQERPVMPEGISPSLAFIVQSCWVEDPNMRPSFSQIIRLLNE
FT                   FLLTLTPPPPQPLPETATNRTNGRAITEFSIRPKGKFAFIRQLFAAKRNINS"
XX
SQ   Sequence 1732 BP; 471 A; 380 C; 377 G; 504 T; 0 other;
     agaagattaa acattcctct cgccggagaa ctaactgctc gatagataga gatagagaga        60
     gagctctgat aactgccatt ctgtctctat ctgcttcctc tagatacacg ttagtttttt       120
     tttctttgaa aggggctaaa tttcgtacac acgacctatt tcttcttctt attggatttt       180
     gtagagaaaa ctttattata taggtttctg gggaatcttc tgagccgttt agaacaagga       240
     tttaggcaaa aatatggtca gttagtttct tgtgctagca attttgaatg ggagattgcg       300
     acgacgacga ctagtctctc ctcgaatcag ggtttatagt tgttgttgat agagatattg       360
     aattggaacc aaaagaactc aatgatagag tagtgaattt tggatgtagt gtttttctca       420
     tcaacggagt aataataaca ataataatga gtagcgatga tacgattgag gagagtttgc       480
     ttgtggatcc caaattgttg ttcatcggct ccaagattgg tgaaggcgct cacggcaaag       540
     tctaccaagg aaggtatggt cgtcagattg ttgcaatcaa agttgtcaac cggggctcca       600
     aacctgacca gcaatcttct ctcgagagcc gtttcgtccg tgaggtcaat atgatgtccc       660
     gcgttcaaca ccataacctt gtcaagttta ttggagcgtg caaagatcct ttaatggtaa       720
     tagtaacaga gcttctccca gggatgtctc tccgtaaata tctcaccagc atccgtcctc       780
     agttgctcca tctccctctt gctctctcct ttgcccttga catcgcccgt gccttgcact       840
     gcttacacgc caatggtatc attcacagag acctcaaacc tgacaactta ttgctcacgg       900
     agaatcacaa atccgtcaag cttgctgatt tcgggcttgc tagggaagaa tccgtgactg       960
     agatgatgac tgctgagact gggacttacc gttggatggc tcctgagctc tacagtacag      1020
     tgaccctgcg tcaaggagag aagaagcatt acaacaacaa agttgatgtc tacagctttg      1080
     gaatcgtgct ttgggagctt ctcactaatc gtatgccatt cgagggcatg tccaatctgc      1140
     aagccgccta cgcagcagca ttcaagcagg agaggcccgt aatgccagag gggatatctc      1200
     cgagtctggc gttcatagtg cagtcttgtt gggtggagga cccaaacatg aggccaagct      1260
     tcagtcaaat tatcagactg ctcaatgagt tcctccttac cctgactcct ccgcctcctc      1320
     agcctctgcc tgagactgcc accaacagga ccaatggccg agccatcact gagttctcca      1380
     tccgtccaaa agggaaattt gccttcattc gccagctttt cgctgccaag aggaacataa      1440
     actcttaggt acaagaaggg gtcttctttg tctttgccac tgccactgct ttggtggata      1500
     aatgacatta gcagagagag agaagtagaa agttagactt acttaaagtc tatagcgtag      1560
     ttaagtactc aatcttcttc ttgtcaagtg attaactggt agtatcacac gccaaactaa      1620
     ttggttaaat gttataactt aaagcctatg ttttatcctt tatcaatact tgaaacaaaa      1680
     cttaggagat caactaacta tgtatattat cgattatata agttttatgt tt              1732
//

If you have problems or comments...

PBIL Back to PBIL home page