(data stored in ACNUC13479 zone)

EMBL: AY142034

ID   AY142034; SV 1; linear; mRNA; STD; PLN; 654 BP.
XX
AC   AY142034;
XX
DT   04-SEP-2002 (Rel. 73, Created)
DT   04-SEP-2002 (Rel. 73, Last updated, Version 1)
XX
DE   Arabidopsis thaliana At5g01750/T20L15_20 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-654
RA   Kim C.J., Chen H., Cheuk R., Shinn P., Bowser L., Carninci P., Chan M.M.,
RA   Chang C.H., Dale J.M., Deng J.M., Hayashizaki Y., Hsuan V.W., Ishida J.,
RA   Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B., Lee J.M., Lin J.,
RA   Miranda M., Narusaka M., Nguyen M., Palm C.J., Quach H.L., Sakurai T.,
RA   Satou M., Seki M., Southwick A., Tang C.C., Toriumi M., Wallender E.K.,
RA   Wong C., Wu H.C., Yamada K., Yu G., Yuan S., Davis R.W., Theologis A.,
RA   Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-654
RA   Kim C.J., Chen H., Cheuk R., Shinn P., Bowser L., Carninci P., Chan M.M.,
RA   Chang C.H., Dale J.M., Deng J.M., Hayashizaki Y., Hsuan V.W., Ishida J.,
RA   Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B., Lee J.M., Lin J.,
RA   Miranda M., Narusaka M., Nguyen M., Palm C.J., Quach H.L., Sakurai T.,
RA   Satou M., Seki M., Southwick A., Tang C.C., Toriumi M., Wallender E.K.,
RA   Wong C., Wu H.C., Yamada K., Yu G., Yuan S., Davis R.W., Theologis A.,
RA   Ecker J.R.;
RT   ;
RL   Submitted (15-AUG-2002) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 81dd2865865ff7cc859cfba13b18efc6.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members constructed and
CC   sequenced the pUNI (ORF) clones using the RAFL cDNAs: Kim,C.J.,
CC   Chen,H., Cheuk,R., Shinn,P., Bowser,L., Chan, M.M., Chang,C.M.,
CC   Dale,J.M., Deng,J.M., Hsuan,V.W., Jones,T., Karlin-Neumann,G.,
CC   Lam,B., Lee,J.M., Lin,J., Miranda,M., Nguyen,M., Palm,C.J.,
CC   Quach,H.L., Southwick,A., Tang,C.C., Toriumi,M., Wallender,E.K.,
CC   Wong,C., Wu,H.C., Yamada,K., Yu,G., Yuan,S., Davis,R.W.,
CC   Theologis,A., and Ecker,J.R.
CC   Kim,C.J. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
CC   contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..654
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /clone="U12372"
FT                   /note="This clone is in pUNI 51 ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..654
FT                   /codon_start=1
FT                   /product="At5g01750/T20L15_20"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9LZX1"
FT                   /db_xref="InterPro:IPR007612"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="InterPro:IPR038595"
FT                   /db_xref="PDB:1ZXU"
FT                   /db_xref="PDB:2Q4M"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZX1"
FT                   /protein_id="AAM98298.1"
FT                   /translation="MEQPYVYAYPQGSGPSGAPTPQAGGVVVDPKYCAPYPIDMAIVRK
FT                   MMSLTDGNFVITDVNGNLLFKVKEPVFGLHDKRVLLDGSGTPVVTLREKMVSMHDRWQV
FT                   FRGGSTDQRDLLYTVKRSSMLQLKTKLDVFLGHNKDEKRCDFRVKGSWLERSCVVYAGE
FT                   SDAIVAQMHRKHTVQSVFLGKDNFSVTVYPNVDYAFIASLVVILDDVNREDRAA"
XX
SQ   Sequence 654 BP; 163 A; 148 C; 190 G; 153 T; 0 other;
     atggagcagc cgtacgtgta cgcatacccg caaggtagtg gcccctcggg agctccgact        60
     ccacaagccg gaggagtggt agtggatcca aagtactgcg ctccttaccc tatagatatg       120
     gcgatcgtac ggaagatgat gtcgttaacg gacggcaatt tcgtgataac ggacgtcaac       180
     ggaaacctgc tgttcaaggt gaaggaaccg gtgtttggtc tccacgacaa gagggtcttg       240
     ctggatggtt ctggtactcc ggtcgtcact ttgagagaaa agatggtgag catgcatgac       300
     aggtggcaag tgtttagagg agggagtacg gatcagcgtg atctgctgta cacggtgaaa       360
     agatcgtcga tgcttcagct aaagaccaaa ctcgatgtgt ttttgggaca caacaaagat       420
     gagaagagat gtgatttcag agtcaaaggg agttggctcg agcgttcttg tgttgtttac       480
     gccggcgaat ctgacgccat tgttgcccaa atgcacagga agcacacggt gcagagcgta       540
     ttcttgggaa aagacaactt ctcggtgact gtttatccaa acgtcgatta tgccttcatc       600
     gcctctctcg tcgtcattct cgatgacgtc aaccgcgaag accgcgccgc ctga             654
//

If you have problems or comments...

PBIL Back to PBIL home page