(data stored in SCRATCH zone)

EMBL: AY142501

ID   AY142501; SV 1; linear; mRNA; STD; PLN; 985 BP.
XX
AC   AY142501;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2002 (Rel. 73, Last updated, Version 1)
XX
DE   Arabidopsis thaliana unknown protein (At4g26260) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-985
RA   Yamada K., Chan M.M., Chang C.H., Dale J.M., Deng J.M., Hsuan V.W.,
RA   Lee J.M., Quach H.L., Tang C.C., Toriumi M., Wallender E.K., Wong C.,
RA   Wu H.C., Yu G., Yuan S., Chen H., Cheuk R., Jones T., Kim C.J., Nguyen M.,
RA   Palm C.J., Shinn P., Southwick A., Tripp M.G., Wu T., Davis R.W.,
RA   Ecker J.R., Theologis A.;
RT   "Arabidopsis Open Reading Frame (ORF) Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-985
RA   Yamada K., Chan M.M., Chang C.H., Dale J.M., Deng J.M., Hsuan V.W.,
RA   Lee J.M., Quach H.L., Tang C.C., Toriumi M., Wallender E.K., Wong C.,
RA   Wu H.C., Yu G., Yuan S., Chen H., Cheuk R., Jones T., Kim C.J., Nguyen M.,
RA   Palm C.J., Shinn P., Southwick A., Tripp M.G., Wu T., Davis R.W.,
RA   Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (16-AUG-2002) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; 904c88b2d21c33d64843ef2d6e8b901c.
XX
CC   Annotation is based on the January 2002 version of the Arabidopsis
CC   genome submitted to GenBank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..985
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="C103414"
FT                   /note="This clone is in pUNI 51. ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..954
FT                   /codon_start=1
FT                   /gene="At4g26260"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:Q8H1S0"
FT                   /db_xref="InterPro:IPR007828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8H1S0"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAN13052.1"
FT                   /translation="MTISVEKPIFEEVSAFEKSGDNIGELKLDGGFSMPKMDTNDDEAF
FT                   LAPEMNAFGRQFRDYDVESERQKGVEEFYRLQHINQTVDFVKKMRAEYGKLDKMVMSIW
FT                   ECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQ
FT                   FGGLPQWAVVGDTFPVGCAFDESNVHHKYFVENPDFHNETYNTKNGIYSEGCGLNNVMM
FT                   SWGHDDYMYLVAKENGSTLPSAGQFIIRYHSFYPLHTAGEYTHLMNEEDKENLKWLHVF
FT                   NKYDLYSKSKVHVDVEKVKPYYMSLIKKYFPENLRW"
FT   3'UTR           955..985
FT                   /gene="At4g26260"
XX
SQ   Sequence 985 BP; 295 A; 184 C; 245 G; 261 T; 0 other;
     atgacgatct ctgttgagaa gccgattttt gaagaggttt ctgcattcga gaagagtggg        60
     gacaatatcg gagagttgaa attggacgga ggattttcga tgccgaaaat ggacaccaat       120
     gacgacgaag cttttttggc tcctgagatg aatgcatttg gccgccaatt cagggactac       180
     gatgttgaga gtgagaggca aaagggcgtc gaagagtttt acagattaca acacatcaac       240
     caaactgtcg actttgtgaa aaagatgagg gctgaatatg gaaaattaga taaaatggtg       300
     atgagcattt gggaatgttg tgagcttctc aatgaggttg tggatgagag tgatccagat       360
     cttgacgagc cccagattca gcatttgctt caatctgccg aagccatccg caaagattac       420
     cctaatgaag attggcttca tctgaccgct cttatccatg atcttgggaa agttattact       480
     cttccacaat tcggaggact tcctcaatgg gctgttgttg gtgacacatt ccctgttgga       540
     tgtgcatttg atgaatctaa cgtacatcac aagtactttg tggaaaaccc agattttcac       600
     aacgaaacct acaacactaa aaatgggatt tactctgaag ggtgtggatt aaacaatgtc       660
     atgatgtctt ggggccatga cgactacatg tacctggtgg ctaaagaaaa cggaagtacc       720
     ttgccgtcgg ctggacagtt tatcataaga taccattcct tttacccttt gcacacggct       780
     ggagaataca cccatcttat gaacgaggaa gacaaggaga atctgaagtg gctacacgtt       840
     ttcaacaagt acgacttgta cagtaagagc aaagttcacg ttgatgtgga gaaggtcaag       900
     ccttactaca tgtctcttat caagaaatat ttcccggaaa acttgaggtg gtgaattcgg       960
     tggagtaaaa aagtgcccat ggagg                                             985
//

If you have problems or comments...

PBIL Back to PBIL home page