(data stored in SCRATCH zone)

EMBL: AY142504

ID   AY142504; SV 1; linear; mRNA; STD; PLN; 1291 BP.
XX
AC   AY142504;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2002 (Rel. 73, Last updated, Version 1)
XX
DE   Arabidopsis thaliana unknown protein (At4g26340) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1291
RA   Yamada K., Chan M.M., Chang C.H., Dale J.M., Deng J.M., Hsuan V.W.,
RA   Lee J.M., Quach H.L., Tang C.C., Toriumi M., Wallender E.K., Wong C.,
RA   Wu H.C., Yu G., Yuan S., Chen H., Cheuk R., Jones T., Kim C.J., Nguyen M.,
RA   Palm C.J., Shinn P., Southwick A., Tripp M.G., Wu T., Davis R.W.,
RA   Ecker J.R., Theologis A.;
RT   "Arabidopsis Open Reading Frame (ORF) Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1291
RA   Yamada K., Chan M.M., Chang C.H., Dale J.M., Deng J.M., Hsuan V.W.,
RA   Lee J.M., Quach H.L., Tang C.C., Toriumi M., Wallender E.K., Wong C.,
RA   Wu H.C., Yu G., Yuan S., Chen H., Cheuk R., Jones T., Kim C.J., Nguyen M.,
RA   Palm C.J., Shinn P., Southwick A., Tripp M.G., Wu T., Davis R.W.,
RA   Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (16-AUG-2002) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; b82591a6e3821310b3e31b37a6546cc6.
XX
CC   Annotation is based on the January 2002 version of the Arabidopsis
CC   genome submitted to GenBank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1291
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="C103417"
FT                   /note="This clone is in pUNI 51. ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..1260
FT                   /codon_start=1
FT                   /gene="At4g26340"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:Q8H1R7"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8H1R7"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAN13055.1"
FT                   /translation="MDRISQLSDDLLLQILSFIPGKDVVATSLLSKRWQSLWMLVSELE
FT                   YDDSYHTGDYKSFSQFVYRSLLSNNAPVIKHLHLNLGPDCPAIDIGLWIGFALTRRLRQ
FT                   LKINIRTSSNDASFSLPSSLYTSDTLETLRLINFVLLDVPSSVCLPSLKVLHLKTVDYE
FT                   DDASLPSLLFGCPNLEELFVERHDQDLEMDVTFVVPSLRRLSMIDKNYGQCDRYVIDVP
FT                   SLKYLNITDDAVYDVRQIENMPELVEAHVDITQGVTHKFLRALTSVRQLSLCLSLSEVM
FT                   CPSGIIFSQLVHLNLSTVVKGWWDLLTSMLQDSPKLQSLKLIDKQHESGLCGIETPIGW
FT                   KLPSSVPECLLFSLEAFEWIGYKGRRGDREVATYVLKNAACLRTAKFSPESTDVGEKYH
FT                   MLKELASVPTASTSSKLLFD"
FT   3'UTR           1261..1291
FT                   /gene="At4g26340"
XX
SQ   Sequence 1291 BP; 320 A; 263 C; 279 G; 429 T; 0 other;
     atggaccgta ttagtcaact ttcggatgat ttgctcttgc aaatattgtc gtttattccg        60
     ggaaaagatg ttgtggccac aagtcttttg tccaaaaggt ggcagtctct ttggatgtta       120
     gtttcggaac ttgagtacga tgatagctac cacactggtg attataagag cttctctcag       180
     tttgtttaca ggtctttgct atcaaacaat gcacctgtta taaaacattt gcatctgaat       240
     cttggccctg actgtcccgc tatagatatt ggactatgga ttggttttgc tcttactcgc       300
     cgtctgcgcc agctgaaaat taatattcgt acttcttcca acgatgcgtc tttcagtttg       360
     ccgagtagcc tatatacctc tgatacatta gagaccttga gactcatcaa tttcgttcta       420
     ttggatgttc cttcttcagt ttgtctcccg tctctcaaag ttctacacct taagactgtt       480
     gattacgaag acgacgcatc tcttccaagt cttttatttg gttgtccaaa tcttgaagag       540
     ttgtttgtgg agcgacatga tcaagactta gaaatggatg tcactttcgt ggtgccttcc       600
     ttacgacggt tatccatgat cgacaaaaat tatggacaat gtgatcgata tgtgatagat       660
     gtcccttctt tgaagtacct taacattaca gatgacgcag tttacgacgt ccgtcaaatt       720
     gagaacatgc ctgagttggt cgaggcacat gttgacatta ctcaaggagt tactcacaag       780
     tttctgaggg ctcttacttc tgtccgacaa ctttctctat gtttatcact ctcagaggtt       840
     atgtgtcctt ctggtataat cttcagtcag cttgttcatc tgaacttgtc tacagttgtt       900
     aaaggttggt gggatcttct tacttctatg ctccaagatt cccccaaact ccaatctctc       960
     aaactcatcg ataaacaaca tgagtcgggt ctttgtggga tagaaacccc aattggttgg      1020
     aagctgccga gttctgttcc cgagtgtttg ttgtttagtc tagaggcatt tgagtggatt      1080
     ggatacaaag ggaggcgagg agatagagag gtggcaacat atgtcctaaa gaatgctgct      1140
     tgtttgagga cagcaaagtt ctctccagag tctactgatg tgggagagaa gtatcatatg      1200
     ctcaaggagt tggcatcagt acctacagct tcaacttcgt ctaagcttct attcgactga      1260
     gaatagtaat atttaggttt cttggtatct c                                     1291
//

If you have problems or comments...

PBIL Back to PBIL home page