(data stored in ACNUC16935 zone)

EMBL: AY168648

ID   AY168648; SV 1; linear; mRNA; STD; HUM; 498 BP.
XX
AC   AY168648;
XX
DT   27-DEC-2002 (Rel. 74, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Homo sapiens ubiquitin-like protein ISG15 mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-498
RA   Kamitani T., Fukuda-Kamitani T.;
RT   "Conjugation by ubiquitin-like proteins";
RL   Unpublished.
XX
RN   [2]
RP   1-498
RA   Kamitani T., Fukuda-Kamitani T.;
RT   ;
RL   Submitted (24-OCT-2002) to the INSDC.
RL   Cardiology, University of Texas M.D. Anderson Cancer Center, 1515 Holcombe
RL   Blvd., Box 449, Houston, TX 77030, USA
XX
DR   MD5; d33281d9b7a875849fb826de865ecb3e.
DR   Ensembl-Gn; ENSG00000187608; homo_sapiens.
DR   Ensembl-Tr; ENST00000379389; homo_sapiens.
DR   EuropePMC; PMC2561335; 18566215.
DR   EuropePMC; PMC3027683; 21298066.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..498
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..498
FT                   /codon_start=1
FT                   /product="ubiquitin-like protein ISG15"
FT                   /db_xref="GOA:P05161"
FT                   /db_xref="H-InvDB:HIT000084912.13"
FT                   /db_xref="HGNC:HGNC:4053"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:1Z2M"
FT                   /db_xref="PDB:2HJ8"
FT                   /db_xref="PDB:3PHX"
FT                   /db_xref="PDB:3PSE"
FT                   /db_xref="PDB:3R66"
FT                   /db_xref="PDB:3RT3"
FT                   /db_xref="PDB:3SDL"
FT                   /db_xref="PDB:5TL6"
FT                   /db_xref="PDB:5W8T"
FT                   /db_xref="PDB:5W8U"
FT                   /db_xref="PDB:6BI8"
FT                   /db_xref="PDB:6FFA"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05161"
FT                   /protein_id="AAN86983.1"
FT                   /translation="MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRL
FT                   AVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTV
FT                   AHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGG
FT                   RS"
XX
SQ   Sequence 498 BP; 96 A; 147 C; 179 G; 76 T; 0 other;
     atgggctggg acctgacggt gaagatgctg gcgggcaacg aattccaggt gtccctgagc        60
     agctccatgt cggtgtcaga gctgaaggcg cagatcaccc agaagatcgg cgtgcacgcc       120
     ttccagcagc gtctggctgt ccacccgagc ggtgtggcgc tgcaggacag ggtccccctt       180
     gccagccagg gcctgggccc cggcagcacg gtcctgctgg tggtggacaa atgcgacgaa       240
     cctctgaaca tcctggtgag gaataacaag ggccgcagca gcacctacga ggtgcggctg       300
     acgcagaccg tggcccacct gaagcagcaa gtgagcgggc tggagggtgt gcaggacgac       360
     ctgttctggc tgaccttcga ggggaagccc ctggaggacc agctcccgct gggggagtac       420
     ggcctcaagc ccctgagcac cgtgttcatg aatctgcgcc tgcggggagg cggcacagag       480
     cctggcgggc ggagctaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page