(data stored in SCRATCH zone)

EMBL: AY232552

ID   AY232552; SV 1; linear; mRNA; STD; PLN; 954 BP.
XX
AC   AY232552;
XX
DT   28-FEB-2004 (Rel. 79, Created)
DT   17-MAR-2004 (Rel. 79, Last updated, Version 2)
XX
DE   Arabidopsis thaliana myo-inositol oxygenase (miox4) mRNA, complete cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-954
RX   DOI; 10.1104/pp.103.033936.
RX   PUBMED; 14976233.
RA   Lorence A., Chevone B.I., Mendes P., Nessler C.L.;
RT   "myo-inositol oxygenase offers a possible entry point into plant ascorbate
RT   biosynthesis";
RL   Plant Physiol. 134(3):1200-1205(2004).
XX
RN   [2]
RP   1-954
RA   Nessler C.L., Lorence A., Mendes P., Chevone B.I.;
RT   ;
RL   Submitted (09-FEB-2003) to the INSDC.
RL   Plant Pathology, Physiology and Weed Science, Virginia Polytechnic
RL   Institute and State University, 413 Price Hall (0331), Blacksburg, Virginia
RL   24061-0331, US
XX
DR   MD5; 4d274cc066d49f9369465ebf5c00c2df.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..954
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone_lib="CD4-7"
FT                   /note="PCR primers based on AT4g2620"
FT                   /db_xref="taxon:3702"
FT   gene            1..954
FT                   /gene="miox4"
FT   CDS_pept        1..954
FT                   /codon_start=1
FT                   /gene="miox4"
FT                   /product="myo-inositol oxygenase"
FT                   /db_xref="GOA:Q8H1S0"
FT                   /db_xref="InterPro:IPR007828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8H1S0"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAP59548.1"
FT                   /translation="MTISVEKPIFEEVSAFEKSGDNIGELKLDGGFSMPKMDTNDDEAF
FT                   LAPEMNAFGRQFRDYDVESERQKGVEEFYRLRHINQTVDFVKKMRAEYGKLDKMVMSIW
FT                   ECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQ
FT                   FGGLPQWAVVGDTFPVGCAFDESNVHHKYFVENPDFHNETYNTKNGIYSEGCGLNNVMM
FT                   SWGHDDYMYLVAKENGSTLPSAGQFIIRYHSFYPLHTAGEYTHLMNEEDKENLKWLHVF
FT                   NKYDLYSKSKVHVDVEKVEPYYMSLIKKYFPENLRW"
XX
SQ   Sequence 954 BP; 283 A; 181 C; 236 G; 254 T; 0 other;
     atgacgatct ctgttgagaa gccgattttt gaagaggttt ctgcattcga gaagagtggg        60
     gacaatatcg gagagttgaa attggacgga ggattttcga tgccgaaaat ggacaccaat       120
     gacgacgaag cttttttggc tcctgagatg aatgcatttg gccgccaatt cagggactac       180
     gatgttgaga gtgagaggca aaagggcgtc gaagagtttt acagattacg acacatcaac       240
     caaactgtcg actttgtgaa aaagatgagg gctgaatatg gaaaattaga taaaatggtg       300
     atgagcattt gggaatgttg tgagcttctc aatgaggttg tggatgagag tgatccagat       360
     cttgacgagc cccagattca gcatttgctt caatctgccg aagccatccg caaagattac       420
     cctaatgaag attggcttca tctgaccgct cttatccatg atcttgggaa agttattact       480
     cttccacaat tcggaggact tcctcaatgg gctgttgttg gtgacacatt ccctgttgga       540
     tgtgcatttg atgaatctaa cgtacatcac aagtactttg tggaaaaccc agattttcac       600
     aacgaaacct acaacactaa aaatgggatt tactctgaag ggtgtggatt aaacaatgtc       660
     atgatgtctt ggggccatga cgactacatg tacctggtgg ctaaagaaaa cggaagtacc       720
     ttgccgtcgg ctggacagtt tatcataaga taccactcct tttacccttt gcacacggct       780
     ggagaataca cccatcttat gaacgaggaa gacaaggaga atctgaagtg gctacacgtt       840
     ttcaacaagt acgacttgta cagtaagagc aaagttcacg ttgatgtgga gaaggtcgag       900
     ccttactaca tgtctcttat caagaaatat ttcccggaaa acttgaggtg gtga             954
//

If you have problems or comments...

PBIL Back to PBIL home page