(data stored in ACNUC9435 zone)

EMBL: AY234241

ID   AY234241; SV 1; linear; mRNA; STD; HUM; 7405 BP.
XX
AC   AY234241;
XX
DT   20-MAR-2003 (Rel. 75, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens SET binding factor 2 (CMT4B2) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-7405
RX   DOI; 10.1093/hmg/ddg030.
RX   PUBMED; 12554688.
RA   Senderek J., Bergmann C., Weber S., Ketelsen U.P., Schorle H.,
RA   Rudnik-Schoneborn S., Buttner R., Buchheim E., Zerres K.;
RT   "Mutation of the SBF2 gene, encoding a novel member of the myotubularin
RT   family, in Charcot-Marie-Tooth neuropathy type 4B2/11p15";
RL   Hum. Mol. Genet. 12(3):349-356(2003).
XX
RN   [2]
RP   1-7405
RA   Senderek J.;
RT   ;
RL   Submitted (12-FEB-2003) to the INSDC.
RL   Department of Human Genetics, Aachen University of Technology,
RL   Pauwelsstrasse 30, 52074 Aachen, Germany
XX
DR   MD5; a45a54a53a4423a7a429e9db606ad70f.
DR   Ensembl-Gn; ENSG00000133812; homo_sapiens.
DR   Ensembl-Tr; ENST00000256190; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7405
FT                   /organism="Homo sapiens"
FT                   /chromosome="11"
FT                   /map="11p15"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="sciatic nerve"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        105..5654
FT                   /codon_start=1
FT                   /gene="CMT4B2"
FT                   /product="SET binding factor 2"
FT                   /note="member of myotubularin-related protein super-family;
FT                   uDENN domain; DENN domain; dDENN domain; GRAM domain;
FT                   putative inactive PTPc_DSPc domain; SET-interacting domain;
FT                   PH domain-containing protein"
FT                   /db_xref="GOA:Q86WG5"
FT                   /db_xref="H-InvDB:HIT000085430.15"
FT                   /db_xref="HGNC:HGNC:2135"
FT                   /db_xref="InterPro:IPR001194"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR005112"
FT                   /db_xref="InterPro:IPR005113"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR022096"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="InterPro:IPR030567"
FT                   /db_xref="InterPro:IPR037516"
FT                   /db_xref="InterPro:IPR037823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q86WG5"
FT                   /protein_id="AAO62733.1"
FT                   /translation="MARLADYFIVVGYDHEKPGSGEGLGKIIQRFPQKDWDDTPFPQGI
FT                   ELFCQPGGWQLSRERKQPTFFVVVLTDIDSDRHYCSCLTFYEAEINLQGTKKEEIEGEA
FT                   KVSGLIQPAEVFAPKSLVLVSRLYYPEIFRACLGLIYTVYVDSLNVSLESLIANLCACL
FT                   VPAAGGSQKLFSLGAGDRQLIQTPLHDSLPITGTSVALLFQQLGIQNVLSLFCAVLTEN
FT                   KVLFHSASFQRLSDACRALESLMFPLKYSYPYIPILPAQLLEVLSSPTPFIIGVHSVFK
FT                   TDVHELLDVIIADLDGGTIKIPECIHLSSLPEPLLHQTQSALSLILHPDLEVADHAFPP
FT                   PRTALSHSKMLDKEVRAVFLRLFAQLFQGYRSCLQLIRIHAEPVIHFHKTAFLGQRGLV
FT                   ENDFLTKVLSGMAFAGFVSERGPPYRSCDLFDELVAFEVERIKVEENNPVKMIKHVREL
FT                   AEQLFKNENPNPHMAFQKVPRPTEGSHLRVHILPFPEINEARVQELIQENVAKNQNAPP
FT                   ATRIEKKCVVPAGPPVVSIMDKVTTVFNSAQRLEVVRNCISFIFENKILETEKTLPAAL
FT                   RALKGKAARQCLTDELGLHVQQNRAILDHQQFDYIIRMMNCTLQDCSSLEEYNIAAALL
FT                   PLTSAFYRKLAPGVSQFAYTCVQDHPIWTNQQFWETTFYNAVQEQVRSLYLSAKEDNHA
FT                   PHLKQKDKLPDDHYQEKTAMDLAAEQLRLWPTLSKSTQQELVQHEESTVFSQAIHFANL
FT                   MVNLLVPLDTSKNKLLRTSAPGDWESGSNSIVTNSIAGSVAESYDTESGFEDSENTDIA
FT                   NSVVRFITRFIDKVCTESGVTQDHIKSLHCMIPGIVAMHIETLEAVHRESRRLPPIQKP
FT                   KILRPALLPGEEIVCEGLRVLLDPDGREEATGGLLGGPQLLPAEGALFLTTYRILFRGT
FT                   PHDQLVGEQTVVRSFPIASITKEKKITMQNQLQQNMQEGLQITSASFQLIKVAFDEEVS
FT                   PEVVEIFKKQLMKFRYPQSIFSTFAFAAGQTTPQIILPKQKEKNTSFRTFSKTIVKGAK
FT                   RAGKMTIGRQYLLKKKTGTIVEERVNRPGWNEDDDVSVSDESELPTSTTLKASEKSTME
FT                   QLVEKACFRDYQRLGLGTISGSSSRSRPEYFRITASNRMYSLCRSYPGLLVVPQAVQDS
FT                   SLPRVARCYRHNRLPVVCWKNSRSGTLLLRSGGFHGKGVVGLFKSQNSPQAAPTSSLES
FT                   SSSIEQEKYLQALLNAVSVHQKLRGNSTLTVRPAFALSPGVWASLRSSTRLISSPTSFI
FT                   DVGARLAGKDHSASFSNSSYLQNQLLKRQAALYIFGEKSQLRNFKVEFALNCEFVPVEF
FT                   HEIRQVKASFKKLMRACIPSTIPTDSEVTFLKALGDSEWFPQLHRIMQLAVVVSEVLEN
FT                   GSSVLVCLEEGWDITAQVTSLVQLLSDPFYRTLEGFQMLVEKEWLSFGHKFSQRSSLTL
FT                   NCQGSGFAPVFLQFLDCVHQVHNQYPTEFEFNLYYLKFLAFHYVSNRFKTFLLDSDYER
FT                   LEHGTLFDDKGEKHAKKGVCIWECIDRMHKRSPIFFNYLYSPLEIEALKPNVNVSSLKK
FT                   WDYYIEETLSTGPSYDWMMLTPKHFPSEDSDLAGEAGPRSQRRTVWPCYDDVSCTQPDA
FT                   LTSLFSEIEKLEHKLNQAPEKWQQLWERVTVDLKEEPRTDRSQRHLSRSPGIVSTNLPS
FT                   YQKRSLLHLPDSSMGEEQNSSISPSNGVERRAATLYSQYTSKNDENRSFEGTLYKRGAL
FT                   LKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEMVIPAGPSMGAPKHTSDKAF
FT                   FDLKTSKRVYNFCAQDGQSAQQWMDKIQSCISDA"
XX
SQ   Sequence 7405 BP; 2151 A; 1643 C; 1628 G; 1983 T; 0 other;
     gctatgccgc tgcagggaaa atgctgagcc ctcccgggcc gggtgggcgg cggccggcga        60
     gggcggcgac ggggacccgc ttcccgagcg cggcggcggc ggccatggcc cggctggctg       120
     actacttcat cgtggtaggc tatgaccacg agaagccagg atcaggagaa ggtctgggga       180
     aaataatcca gagatttcca cagaaggact gggatgatac accttttcca cagggaattg       240
     agttgttttg tcagcctggc gggtggcagc tgtccagaga gaggaagcag ccaacgttct       300
     ttgtggttgt cctgacagac attgactcag atcgacatta ctgctcatgc ctaaccttct       360
     atgaggcaga gatcaatctt cagggaacaa agaaggaaga gattgaaggt gaagcaaaag       420
     tgtctggttt aattcagcct gcagaagtgt ttgctcccaa aagcctggtg ttggtatcca       480
     gattatatta tccagaaatt tttagggctt gcctgggttt gatctatacc gtgtatgtgg       540
     acagcctgaa tgtctccttg gaaagtctaa ttgcaaacct ttgtgcctgc cttgtcccag       600
     cggctggagg gtctcagaag ctgttttctt tgggtgcagg agatagacag ttgatccaga       660
     ctcctttaca tgatagtctt cctatcacgg gcactagtgt ggctctcctg ttccagcaat       720
     tgggaattca aaatgtcctc agcctctttt gtgcagtcct cacagaaaat aaggttctct       780
     tccattctgc aagtttccag agacttagtg atgcttgtag agccctggaa tctttaatgt       840
     ttcctcttaa atatagttat ccttatatcc ctattctccc ggctcagcta ctggaagttc       900
     taagttcccc aacgcctttc attattggag tacattctgt ctttaaaact gatgtccatg       960
     aacttttaga tgtaatcata gcagatttgg atggaggcac tattaaaatt cccgaatgta      1020
     ttcacctctc ttccctccca gaaccacttc tacatcagac tcaatcagct ctttctttga      1080
     ttttacaccc agatttggaa gtagcagatc atgcttttcc tcctccacga acagctttat      1140
     cccactcaaa aatgctggat aaagaggtgc gagccgtttt ccttagatta tttgcacaac      1200
     tcttccaagg atatagatcc tgcctgcaac ttataagaat tcatgcagag ccagtaatac      1260
     atttccacaa gacagcattc ttggggcagc gtggtttggt cgagaatgat ttcctcacta      1320
     aagtactcag tggaatggca tttgcaggtt ttgtttcaga aagaggtcct ccttatagat      1380
     cttgtgatct ctttgatgag ttggtagcct ttgaagtaga gagaattaaa gttgaagaaa      1440
     ataacccagt gaagatgata aagcatgtca gggaacttgc tgagcaacta ttcaaaaatg      1500
     agaatccaaa tcctcatatg gcattccaga aagttccacg gccaacagaa ggatcccatt      1560
     tgcgagttca tattcttcct ttcccagaga ttaatgaagc ccgggttcag gaattaatac      1620
     aggaaaatgt tgctaagaac cagaatgcac ctcctgccac acgaatagaa aagaaatgtg      1680
     ttgtgccagc aggtccacct gttgtttcga taatggacaa ggtgacgaca gttttcaaca      1740
     gtgcacaaag actagaagtt gtcagaaact gtatctcatt catatttgaa aataaaattt      1800
     tggaaactga aaagaccctt cctgctgcac tcagagccct taaaggaaag gcagcaagac      1860
     agtgtctcac tgatgaattg ggtttgcatg tccagcaaaa ccgggcaata ttagaccatc      1920
     aacagtttga ctacataata aggatgatga attgtactct acaggattgt tcaagtttag      1980
     aagaatacaa cattgccgca gcattactcc ctttgaccag tgctttctat aggaaacttg      2040
     cccctggagt cagccagttt gcttacacgt gtgtacaaga ccaccccatt tggacaaatc      2100
     agcaattttg ggagacaacc ttttacaatg cagtgcagga acaggttcgc tccctttatc      2160
     tctcagccaa ggaagacaat catgccccgc atctgaagca aaaggataag cttcctgatg      2220
     accattatca ggagaagaca gcaatggacc tggcagctga gcaactacgc ctttggccta      2280
     ccctgagcaa gtcaactcag caagagctag tgcaacatga ggaaagcact gtctttagtc      2340
     aggccattca ctttgcaaac ctcatggtga acctgctagt tccactcgac acaagtaaaa      2400
     acaagctcct aagaacatca gcgccaggtg actgggagag cggaagcaac agcattgtca      2460
     caaacagtat tgcaggaagt gtagctgaga gctatgatac agagagtggg tttgaagatt      2520
     cagagaatac tgacattgcc aattctgttg tgcggttcat tacccgattt attgacaaag      2580
     tttgtacaga gagtggagtt actcaggatc acatcaagag ccttcattgc atgataccag      2640
     gaattgtagc tatgcacatt gagaccctag aagcagtaca tcgagaaagc agaagacttc      2700
     cgcctattca gaagcccaag attcttagac ctgctctgct gccaggagaa gaaattgtct      2760
     gtgagggtct tcgagtcttg ctggatcctg atggaagaga agaagctact ggaggtcttc      2820
     ttggaggccc tcagctcctg ccagcagaag gagccttgtt cctcaccaca tacagaattc      2880
     tcttcagagg aacaccccat gatcagttag tgggtgagca gacagttgtg cggagctttc      2940
     ccattgcctc catcaccaag gagaagaaga ttacaatgca gaaccagcta cagcagaaca      3000
     tgcaagaagg actgcagatc acatcagcat cttttcagtt gattaaggta gcatttgatg      3060
     aagaagtcag tccagaagta gtagagatct ttaagaaaca gctgatgaag ttccgttatc      3120
     ctcagtccat tttcagtacc tttgcttttg ctgctggaca aactacccca caaataattt      3180
     taccaaaaca gaaggaaaag aacacttctt ttcgtacctt ctcaaaaaca attgtgaaag      3240
     gtgccaaaag ggcagggaaa atgacaattg ggcggcaata tttactgaag aagaagacag      3300
     ggacaattgt ggaagaaaga gtaaatcgtc ctggatggaa tgaagatgat gatgtatctg      3360
     tttcagatga gagtgagctc cccacaagta ccaccctgaa ggcctccgag aagtctacaa      3420
     tggaacagtt ggtggaaaaa gcttgtttca gagactatca gcgtttaggt ttaggaacca      3480
     taagtggcag ctcttcccgt tcaagacccg agtattttag aattactgcc tccaacagga      3540
     tgtattcact ctgccggagc tatcctggcc ttttagtcgt acctcaagct gtacaggaca      3600
     gtagtttacc aagagtagct cgctgctatc gacacaatcg cctgcctgtt gtatgttgga      3660
     agaactcaag aagtggtact ctgctcctcc gatctggagg attccatggg aagggagtcg      3720
     ttggtctttt caaatctcag aactcccctc aggccgctcc tacctcctct ttagaatctt      3780
     ccagtagcat agaacaagag aaatacttgc aagccttact gaatgctgtt tctgtccatc      3840
     agaaactcag aggcaacagc actcttactg tcaggccagc ctttgctcta tctccaggtg      3900
     tgtgggcaag tcttcgctct agcactcgct tgatcagctc tccaacatcc ttcattgatg      3960
     ttggcgcccg gctggcaggc aaggatcact cggcctcctt cagtaacagc agctacctac      4020
     aaaaccagct cttgaaacgg caagcagccc tttacatatt tggtgaaaag tcgcaactaa      4080
     ggaacttcaa ggtagaattt gctttaaatt gtgagtttgt tcctgttgaa tttcatgaaa      4140
     tccggcaagt gaaagccagt tttaagaagc tgatgagggc ttgtatccca agcaccatcc      4200
     ctactgactc agaagtgacc ttcctgaaag cgctgggaga ttctgagtgg ttcccacagc      4260
     ttcacaggat aatgcagctg gctgtggttg tatcagaagt acttgagaat ggttcctcag      4320
     ttttggtctg tttggaggaa ggctgggaca tcactgcaca agtgacatcc ctggttcagt      4380
     tactcagtga tcccttttat aggacacttg aaggcttcca gatgttggtt gaaaaagagt      4440
     ggctctcttt tggtcacaaa ttcagtcaga ggagcagctt gaccctcaac tgtcagggga      4500
     gtggttttgc tccagtcttc ttacagttct tagactgtgt acaccaggtt cacaaccagt      4560
     atccaactga gtttgaattc aatctctatt acttaaagtt cttggctttc cactatgtgt      4620
     ctaatcgctt taaaacattt ctcctggatt cagactatga aagattagag cacggaactt      4680
     tatttgatga taaaggagaa aagcatgcca aaaaaggagt ctgtatttgg gaatgtattg      4740
     acagaatgca caagaggagt cccattttct ttaattattt atattcacca ttggaaatag      4800
     aggctctaaa gcccaatgta aacgtctcta gcctcaagaa gtgggattac tacatagaag      4860
     agaccctgtc cacaggccct tcctatgact ggatgatgct aacccccaag cacttcccct      4920
     ccgaagactc tgacctggct ggagaagctg ggccacggag ccagaggaga acagtgtggc      4980
     catgctatga tgatgtcagc tgtactcagc ctgatgctct caccagcctt ttcagtgaaa      5040
     ttgaaaaatt ggagcacaaa ttgaaccaag cccctgagaa gtggcagcag ctgtgggaaa      5100
     gggtaaccgt ggaccttaaa gaagaaccaa gaacagatcg ctcccaaaga cacctgtcga      5160
     gatccccagg aattgtgtct accaacctac cttcctatca gaagaggtct ctgctacatc      5220
     tcccagacag cagcatgggg gaggaacaga attccagcat ctccccatcc aatggagtgg      5280
     agcgaagagc agccacgctc tatagccagt atacatccaa gaatgatgaa aacaggtcct      5340
     ttgagggaac actttataaa agaggggctt tgctgaaagg ttggaagccc cgttggtttg      5400
     ttttggatgt aacaaaacat cagctgcgct actatgactc aggtgaggac acaagctgta      5460
     aaggccacat tgatctggct gaagtagaaa tggtcatccc tgctggcccc agcatgggag      5520
     ccccaaagca cacaagtgac aaggctttct ttgatctcaa gaccagcaaa cgtgtgtata      5580
     acttctgcgc ccaggatgga cagagtgccc agcaatggat ggacaagatc cagagttgta      5640
     tctctgatgc ctgatgccca tggtcaaccc acgcagaaga aacagaagaa ctcatgctgc      5700
     cagatagata gaaaaagaag catggatcct tgaggagctg acaacaagtt atcccagggc      5760
     ctgaggttct cctgcccagt cccctcttgc aggggttgct atatctactt aacctgaata      5820
     ggtgtttcac acaggtctgg tcaacagccc catgcactcc ctgtatcttg cactaaattt      5880
     ttctaacagg gtcttagtgg ttaatgatca gaagatgtct cctgagccaa ctgtgaacct      5940
     cacccaggca aaatggctac cacctacttg ggtccttctt catgaaagct atagatcctt      6000
     ttttgttctc tgaggtcata atttcctcgg agacctgttt aacaagcaaa aatcaaaacc      6060
     ctccaagatt gtctcatatt ctacctggac taggtttcct atgagagaca tctacttgta      6120
     atgcctgacc tttgagatgc tcagttctct ggtgctgcca aaagatgctt ccatggtccg      6180
     tgctctgcca gtggggttca caacaagaga cgtcattgtt cagtagcagg caaagaggga      6240
     gcacacagca ttattctgat ggaaaaagat tatccaggga atggtacaac aatgaccagc      6300
     ccaatgcagg aaaacactac ttccaaaaca ctgaattctc tagaccagag gtgctctgag      6360
     gatccagggc cttgtgttct tatgtatctt ctgcttcctg acagcttctt tttcaaaata      6420
     acatgcaaaa aaagctgaat gcactaactc acaaaacaaa cacttgcact gaattcccaa      6480
     tgaagtgaag atgttggaaa gacagaggcc agctatttag gaccatacgc acctgtgaca      6540
     agggctgtgt tgaccacagt cacactgtgg catgactgga tacccaaact acacttctac      6600
     acatgaaaag taagaactgt ctttagattt tctttacttt gataacttgt gattgtttag      6660
     cttaagaccc aagaaatgct gtttgctcat ggtaaacaga aacagcatct tcgctacaac      6720
     cactgacacc agctggcgtc ataggtagct agatcattgc atttgttttg aaatgttaat      6780
     atgttaaata ctaaactaat atttcaaaaa tgtgtatata tgatttctat atccttgttt      6840
     ttcagatagc ctgcttataa tttaatataa attaactgat gcattcataa gatttcaata      6900
     atgaaatggt tcccttttaa aaaataaaaa tactttgtag attaaaaata aatcagaatt      6960
     tcaaatttaa aattgtccac acactaggaa atagaactgt gttaatatat aagaaatctg      7020
     gggataatta agaatgaagg acttttctat catttccatt ttataaattg ccacctgtga      7080
     aaatggtttt tgcacattat ttgtattttt ctttgtatat gaaataattt tttgtacttt      7140
     gtaaaatatg gagcccattg taccttcagc tatttgagac tatacacagt gcttcttttg      7200
     taactggatt actttaactt tcgtgaaggc attacattgc ctcacattca ctaaccacct      7260
     tgaattaaat ttatttctta agaaaaagca tccctcattt actgtgaact aaagttcatt      7320
     ctgtagtgca cagcattcag gagggtaaca ctcaggattc atacatggga ctaaaggttc      7380
     aagaataaaa caaagcatga cccac                                            7405
//

If you have problems or comments...

PBIL Back to PBIL home page