(data stored in ACNUC13479 zone)

EMBL: AY271677

ID   AY271677; SV 1; linear; mRNA; STD; PLN; 999 BP.
XX
AC   AY271677;
XX
DT   23-APR-2003 (Rel. 75, Created)
DT   07-APR-2004 (Rel. 79, Last updated, Version 2)
XX
DE   Arabidopsis thaliana transcription factor GT-3a (GT3A) mRNA, complete cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-999
RX   DOI; 10.1016/S0014-5793(04)00222-4.
RX   PUBMED; 15044016.
RA   Ayadi M., Delaporte V., Li Y.F., Zhou D.X.;
RT   "Analysis of GT-3a identifies a distinct subgroup of trihelix DNA-binding
RT   transcription factors in Arabidopsis";
RL   FEBS Lett. 562(1-3):147-154(2004).
XX
RN   [2]
RP   1-999
RA   Ayadi M., Delaporte V., Li Y.F., Thomasset B., Zhou D.X.;
RT   ;
RL   Submitted (08-APR-2003) to the INSDC.
RL   Genetique Moleculaire des Plantes, Universite de Picardie Jules Verne, 33,
RL   rue Saint-Leu, Amiens 80039, France
XX
DR   MD5; 7af26c26091acdfd84b5488c7214c7ae.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..999
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /map="between LAX1 and CER3"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:3702"
FT   gene            1..999
FT                   /gene="GT3A"
FT   CDS_pept        1..972
FT                   /codon_start=1
FT                   /gene="GT3A"
FT                   /product="transcription factor GT-3a"
FT                   /note="DNA-binding protein"
FT                   /db_xref="GOA:Q9SDW0"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR027759"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SDW0"
FT                   /protein_id="AAP13347.1"
FT                   /translation="MDRRNPFQHHHHHHQLHHHLIQQQQLPPPPLSTTATMDPGGGGGG
FT                   GERIPQWSIEETKELLAIREELDQTFMETKRNKLLWEVVAAKMADKGFVRSAEQCKSKW
FT                   KNLVTRYKACETTEPDAIRQQFPFYNEIQSIFEARMQRMLWSEATEPSTSSKRKHHQFS
FT                   SDDEEEEVDEPNQDINEELLSLVETQKRETEVITTSTSTNPRKRAKKGKGVASGTKAET
FT                   AGNTLKDILEEFMRQTVKMEKEWRDAWEMKEIEREKREKEWRRRMAELEEERAATERRW
FT                   MEREEERRLREEARAQKRDSLIDALLNRLNRDHNDDHHNQGF"
XX
SQ   Sequence 999 BP; 349 A; 177 C; 277 G; 196 T; 0 other;
     atggaccgac gtaacccttt ccaacatcac caccaccacc atcagcttca tcatcacttg        60
     atccaacagc aacagcttcc tccgccgccg ctgagcacca cggcgacgat ggatcccggc       120
     ggaggaggag gaggtgggga gagaatccca cagtggagca tagaggagac aaaggagctt       180
     ttggctataa gagaagaact tgatcaaact ttcatggaga ccaaacgtaa taagcttctt       240
     tgggaagtcg tggctgctaa gatggccgac aagggttttg tccgaagcgc agaacaatgt       300
     aagagcaagt ggaagaacct cgtcactaga tacaaggcgt gtgagaccac tgagccagat       360
     gctattaggc agcagttccc attctacaat gagattcagt cgatttttga agcaagaatg       420
     caaagaatgc tgtggtcaga agccacagaa ccaagcactt cctcgaagag aaaacatcat       480
     caattttcat ctgatgatga agaagaagaa gttgacgaac caaatcaaga tatcaacgag       540
     gaattattgt ctttagtaga gacacagaaa agagagacag aagtgattac tactagtact       600
     tcgaccaatc caagaaaacg tgcaaaaaaa ggaaaaggcg ttgcgagtgg tacgaaagct       660
     gaaactgcgg gtaatacact aaaagatata ttggaggagt ttatgaggca aacggtgaag       720
     atggaaaagg aatggagaga tgcatgggag atgaaggaga tagagaggga gaagagagag       780
     aaagagtggc ggaggagaat ggcggagcta gaggaggaaa gagccgccac agaaaggagg       840
     tggatggaga gagaggaaga gagacggttg agagaagaag ctagggctca gaagagagat       900
     tctctcatcg atgctttgct taataggctt aatagagatc ataatgatga tcatcataat       960
     caaggtttct aagttctcat tatttgtgtt aagcataag                              999
//

If you have problems or comments...

PBIL Back to PBIL home page