(data stored in ACNUC18858 zone)

EMBL: AY283763

ID   AY283763; SV 1; linear; mRNA; STD; MAM; 2128 BP.
XX
AC   AY283763;
XX
DT   02-JUL-2003 (Rel. 76, Created)
DT   27-APR-2004 (Rel. 79, Last updated, Version 2)
XX
DE   Bos taurus type 1 mucus-type core 2
DE   beta-1,6-N-acetylglucosaminyltransferase mRNA, complete cds; alternatively
DE   spliced.
XX
KW   .
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RP   1-2128
RX   PUBMED; 14592928.
RA   Choi K.H., Osorio F.A., Cheng P.-W.;
RT   "Mucin biosynthesis: bovine C2GnT-M gene, tissue-specific expression, and
RT   herpes virus-4 homologue";
RL   Am. J. Respir. Cell Mol. Biol. 30(5):710-719(2004).
XX
RN   [2]
RP   1-2128
RA   Choi K.H., Osorio F.A., Cheng P.-W.;
RT   "Mucin Biosynthesis: Characterization of the cDNAs and Genomic Structure of
RT   Bovine Mucus-type Core 2 beta-1,6-N-acetylglucosaminyltransferase";
RL   Unpublished.
XX
RN   [3]
RP   1-2128
RA   Choi K.H., Cheng P.-W.;
RT   ;
RL   Submitted (22-APR-2003) to the INSDC.
RL   Biochemistry and Molecular Biology, University of Nebraska Medical Center,
RL   984525 Nebraska Medical Center, Omaha, NE 68198, USA
XX
DR   MD5; 619829b51febcfac548fbc0371dd231e.
DR   Ensembl-Gn; ENSBTAG00000009443; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000012427; bos_taurus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2128
FT                   /organism="Bos taurus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="tracheal epithelium; testis"
FT                   /db_xref="taxon:9913"
FT   5'UTR           1..365
FT                   /note="type 1; alternatively spliced"
FT   CDS_pept        366..1688
FT                   /codon_start=1
FT                   /product="mucus-type core 2
FT                   beta-1,6-N-acetylglucosaminyltransferase"
FT                   /note="glycosyltransferase"
FT                   /db_xref="GOA:Q7YQE1"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7YQE1"
FT                   /protein_id="AAP76324.1"
FT                   /translation="MKMTGWKKKLCRGHHLWALGCYMLLAVVALRLSLRLKCDVDSLDL
FT                   ESRDFQSQRCRDVLYKNLKLPAKRSINCSGITRGDQEAVVQALLDNLEVKKKRLPFTDT
FT                   YYLNITRDCEQFKAQRKFIQFPLSKEELDFPIAYSMVVHEKIENFERLLRAVYAPQNIY
FT                   CVHVDVKSPETFKEAVKAIISCFPNVFMASKLVPVVYASWSRVQADLNCMEDLLQSSVP
FT                   WKYLLNTCGTDFPIKTNAEMVLALKMLNGKNSMESEIPSESKKNRWKYRYEVTDRLYLT
FT                   SKMKDPPPDNLPMFTGNAYFVASRAFVQHVLENPKSQRLIEWVKDTYSPDEHLWATLQR
FT                   APWMPGSVPYHPKYHISDMTAIARLVKWQGHEGDVSMGAPYAPCSGIHQRAICIYGAGD
FT                   LHWILQNHHLLANKFDPRVDDNVLQCLEEYLRHKAIYGTEL"
FT   3'UTR           1689..2128
FT   regulatory      2094..2099
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 2128 BP; 548 A; 512 C; 555 G; 513 T; 0 other;
     gctgtggcca ttcctttacg tgcctgcact gaatccggtt aacagtaacg gaggacagag        60
     acactaggct cttcaggaga ggtctggatc tcaggcaaag aggatctcca ctgagctcag       120
     tgacccagag attaagggag gagcctgcca cagtctcttg gatgtcctgt ggaagttaga       180
     aaacatattc tggagaggct gaaaggagac caggagatat ggtgttcatg ttcgcttcca       240
     tagaacccga cccttggaaa aagaaacaca ccgtggcaat agatcttccc tagataggac       300
     agaagcgatt aaaggatctc ctcctccacc ttccctgtgc ccaaactcta ctgatctccc       360
     atcccatgaa gatgactggg tggaagaaga agctttgccg ggggcatcat ctgtgggctc       420
     tgggctgcta tatgctgctg gccgttgttg ctctgaggct ttctctcagg ttgaaatgtg       480
     atgtagattc cttggatctg gagtccaggg acttccaaag tcagcgttgt agggacgtct       540
     tgtacaagaa cctgaagctg ccagcaaaga gatccatcaa ctgttctggg atcacacgag       600
     gggaccagga agcggtggtc caggctctcc tggacaacct ggaagtcaag aagaagcggt       660
     tgcctttcac tgacacctat tacctcaaca taaccagaga ctgtgagcag tttaaggccc       720
     aaaggaagtt catacagttc ccactgagca aagaagagtt agacttcccc attgcatact       780
     cgatggtggt ccatgagaag attgaaaact ttgaacggct gctgcgagct gtgtatgccc       840
     ctcagaacat atactgtgtc catgtggatg tgaagtcccc agaaactttc aaagaggcag       900
     tcaaggccat tatttcctgc ttccccaatg tcttcatggc cagtaagttg gtcccagtgg       960
     tttatgcctc ctggtccaga gtgcaggctg acctgaactg tatggaagac ttgctccaga      1020
     gctcggtgcc atggaaatac ttactgaata catgtgggac agacttcccc ataaagacca      1080
     acgccgagat ggttctggcc ctcaagatgt tgaatgggaa gaacagtatg gagtctgaga      1140
     taccttctga gtccaaaaaa aatcgctgga aataccgcta tgaggtgaca gacagactgt      1200
     acctaaccag caagatgaag gaccctcccc ctgataattt acctatgttc acggggaatg      1260
     cctattttgt ggcttctcga gcctttgtcc aacatgtctt agagaacccc aaatcccaaa      1320
     gactgattga atgggtcaaa gacacctata gccccgacga acacctctgg gccacccttc      1380
     agcgtgctcc atggatgcct ggctctgttc cttaccaccc caagtatcac atctcagaca      1440
     tgactgccat cgccaggctg gtcaagtggc agggccacga gggagatgtc agcatggggg      1500
     cgccttatgc accctgctct ggaatccatc agcgggccat ctgcatttac ggggccgggg      1560
     acctgcactg gattctccag aaccatcacc tcttggcaaa caagtttgac ccaagggtgg      1620
     atgataacgt cctgcagtgc ttagaagagt atttacgtca taaggccatc tatgggactg      1680
     aactttgagc tgtactgtgg gcggatcgct acccaagggc cagggacatg tgccaacatg      1740
     cccagggcgt actggtactg tgtggggtgg gggacgaggg ctgtggaatt catggcatcc      1800
     cccagggtca gagggctgct tttggagtgt ggagagtaga tatgctgact tgcagactgc      1860
     ttccctgggt gaacactgac tcagcccact tccaatagct ccttcacaca ctttctcgct      1920
     gagttcataa tacgaaccag ctgtctgggc aagtgtggga ggagaccctg gatttcagtt      1980
     gaattggtat tgagttttcc actctctaga ggtgccattc ctaataattc taggcttggt      2040
     agtggggagg ggactttgat ggacagaagg cttctgtttt gtactattaa cttaataaat      2100
     agcttttgat taaaaaaaaa aaaaaaaa                                         2128
//

If you have problems or comments...

PBIL Back to PBIL home page