(data stored in ACNUC18858 zone)

EMBL: AY283765

ID   AY283765; SV 1; linear; mRNA; STD; MAM; 2000 BP.
XX
AC   AY283765;
XX
DT   02-JUL-2003 (Rel. 76, Created)
DT   27-APR-2004 (Rel. 79, Last updated, Version 2)
XX
DE   Bos taurus type 3 mucus-type core 2
DE   beta-1,6-N-acetylglucosaminyltransferase mRNA, complete cds; alternatively
DE   spliced.
XX
KW   .
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RP   1-2000
RX   PUBMED; 14592928.
RA   Choi K.H., Osorio F.A., Cheng P.-W.;
RT   "Mucin biosynthesis: bovine C2GnT-M gene, tissue-specific expression, and
RT   herpes virus-4 homologue";
RL   Am. J. Respir. Cell Mol. Biol. 30(5):710-719(2004).
XX
RN   [2]
RP   1-2000
RA   Choi K.H., Osorio F.A., Cheng P.-W.;
RT   "Mucin Biosynthesis: Characterization of the cDNAs and Genomic Structure of
RT   Bovine Mucus-type Core 2 beta-1,6-N-acetylglucosaminyltransferase";
RL   Unpublished.
XX
RN   [3]
RP   1-2000
RA   Choi K.H., Cheng P.-W.;
RT   ;
RL   Submitted (22-APR-2003) to the INSDC.
RL   Biochemistry and Molecular Biology, University of Nebraska Medical Center,
RL   984525 Nebraska Medical Center, Omaha, NE 68198, USA
XX
DR   MD5; c251695f8cd7fcd7707df707759b6055.
DR   Ensembl-Gn; ENSBTAG00000009443; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000012427; bos_taurus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2000
FT                   /organism="Bos taurus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="colon; stomach; small intestine"
FT                   /db_xref="taxon:9913"
FT   5'UTR           1..237
FT                   /note="type 3; alternatively spliced"
FT   CDS_pept        238..1560
FT                   /codon_start=1
FT                   /product="mucus-type core 2
FT                   beta-1,6-N-acetylglucosaminyltransferase"
FT                   /note="glycosyltransferase"
FT                   /db_xref="GOA:Q7YQE1"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7YQE1"
FT                   /protein_id="AAP76326.1"
FT                   /translation="MKMTGWKKKLCRGHHLWALGCYMLLAVVALRLSLRLKCDVDSLDL
FT                   ESRDFQSQRCRDVLYKNLKLPAKRSINCSGITRGDQEAVVQALLDNLEVKKKRLPFTDT
FT                   YYLNITRDCEQFKAQRKFIQFPLSKEELDFPIAYSMVVHEKIENFERLLRAVYAPQNIY
FT                   CVHVDVKSPETFKEAVKAIISCFPNVFMASKLVPVVYASWSRVQADLNCMEDLLQSSVP
FT                   WKYLLNTCGTDFPIKTNAEMVLALKMLNGKNSMESEIPSESKKNRWKYRYEVTDRLYLT
FT                   SKMKDPPPDNLPMFTGNAYFVASRAFVQHVLENPKSQRLIEWVKDTYSPDEHLWATLQR
FT                   APWMPGSVPYHPKYHISDMTAIARLVKWQGHEGDVSMGAPYAPCSGIHQRAICIYGAGD
FT                   LHWILQNHHLLANKFDPRVDDNVLQCLEEYLRHKAIYGTEL"
FT   3'UTR           1561..2000
FT   regulatory      1966..1971
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 2000 BP; 516 A; 479 C; 519 G; 486 T; 0 other;
     agattaaggg aggagcctgc cacagtctct tggatgtcct gtggaagtta gaaaacatat        60
     tctggagagg ctgaaaggag accaggagat atggtgttca tgttcgcttc catagaaccc       120
     gacccttgga aaaagaaaca caccgtggca atagatcttc cctagatagg acagaagcga       180
     ttaaaggatc tcctcctcca ccttccctgt gcccaaactc tactgatctc ccatcccatg       240
     aagatgactg ggtggaagaa gaagctttgc cgggggcatc atctgtgggc tctgggctgc       300
     tatatgctgc tggccgttgt tgctctgagg ctttctctca ggttgaaatg tgatgtagat       360
     tccttggatc tggagtccag ggacttccaa agtcagcgtt gtagggacgt cttgtacaag       420
     aacctgaagc tgccagcaaa gagatccatc aactgttctg ggatcacacg aggggaccag       480
     gaagcggtgg tccaggctct cctggacaac ctggaagtca agaagaagcg gttgcctttc       540
     actgacacct attacctcaa cataaccaga gactgtgagc agtttaaggc ccaaaggaag       600
     ttcatacagt tcccactgag caaagaagag ttagacttcc ccattgcata ctcgatggtg       660
     gtccatgaga agattgaaaa ctttgaacgg ctgctgcgag ctgtgtatgc ccctcagaac       720
     atatactgtg tccatgtgga tgtgaagtcc ccagaaactt tcaaagaggc agtcaaggcc       780
     attatttcct gcttccccaa tgtcttcatg gccagtaagt tggtcccagt ggtttatgcc       840
     tcctggtcca gagtgcaggc tgacctgaac tgtatggaag acttgctcca gagctcggtg       900
     ccatggaaat acttactgaa tacatgtggg acagacttcc ccataaagac caacgccgag       960
     atggttctgg ccctcaagat gttgaatggg aagaacagta tggagtctga gataccttct      1020
     gagtccaaaa aaaatcgctg gaaataccgc tatgaggtga cagacagact gtacctaacc      1080
     agcaagatga aggaccctcc ccctgataat ttacctatgt tcacggggaa tgcctatttt      1140
     gtggcttctc gagcctttgt ccaacatgtc ttagagaacc ccaaatccca aagactgatt      1200
     gaatgggtca aagacaccta tagccccgac gaacacctct gggccaccct tcagcgtgct      1260
     ccatggatgc ctggctctgt tccttaccac cccaagtatc acatctcaga catgactgcc      1320
     atcgccaggc tggtcaagtg gcagggccac gagggagatg tcagcatggg ggcgccttat      1380
     gcaccctgct ctggaatcca tcagcgggcc atctgcattt acggggccgg ggacctgcac      1440
     tggattctcc agaaccatca cctcttggca aacaagtttg acccaagggt ggatgataac      1500
     gtcctgcagt gcttagaaga gtatttacgt cataaggcca tctatgggac tgaactttga      1560
     gctgtactgt gggcggatcg ctacccaagg gccagggaca tgtgccaaca tgcccagggc      1620
     gtactggtac tgtgtggggt gggggacgag ggctgtggaa ttcatggcat cccccagggt      1680
     cagagggctg cttttggagt gtggagagta gatatgctga cttgcagact gcttccctgg      1740
     gtgaacactg actcagccca cttccaatag ctccttcaca cactttctcg ctgagttcat      1800
     aatacgaacc agctgtctgg gcaagtgtgg gaggagaccc tggatttcag ttgaattggt      1860
     attgagtttt ccactctcta gaggtgccat tcctaataat tctaggcttg gtagtgggga      1920
     ggggactttg atggacagaa ggcttctgtt ttgtactatt aacttaataa atagcttttg      1980
     attaaaaaaa aaaaaaaaaa                                                  2000
//

If you have problems or comments...

PBIL Back to PBIL home page