(data stored in ACNUC18858 zone)

EMBL: AY283767

ID   AY283767; SV 1; linear; genomic DNA; STD; MAM; 5124 BP.
XX
AC   AY283767;
XX
DT   02-JUL-2003 (Rel. 76, Created)
DT   27-APR-2004 (Rel. 79, Last updated, Version 2)
XX
DE   Bos taurus mucus-type core 2 beta-1,6-N-acetylglucosaminyltransferase gene,
DE   complete cds; alternatively spliced.
XX
KW   .
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RP   1-5124
RX   PUBMED; 14592928.
RA   Choi K.H., Osorio F.A., Cheng P.-W.;
RT   "Mucin biosynthesis: bovine C2GnT-M gene, tissue-specific expression, and
RT   herpes virus-4 homologue";
RL   Am. J. Respir. Cell Mol. Biol. 30(5):710-719(2004).
XX
RN   [2]
RP   1-5124
RA   Choi K.H., Osorio F.A., Cheng P.-W.;
RT   "Mucin Biosynthesis: Characterization of the cDNAs and Genomic Structure of
RT   Bovine Mucus-type Core 2 beta-1,6-N-acetylglucosaminyltransferase";
RL   Unpublished.
XX
RN   [3]
RP   1-5124
RA   Choi K.H., Cheng P.-W.;
RT   ;
RL   Submitted (22-APR-2003) to the INSDC.
RL   Biochemistry and Molecular Biology, University of Nebraska Medical Center,
RL   984525 Nebraska Medical Center, Omaha, NE 68198, USA
XX
DR   MD5; 35e3564f70648c30ecd7baa0df907263.
DR   Ensembl-Gn; ENSBTAG00000009443; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000012427; bos_taurus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5124
FT                   /organism="Bos taurus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9913"
FT   mRNA            join(1..128,1556..5124)
FT                   /product="mucus-type core 2
FT                   beta-1,6-N-acetylglucosaminyltransferase"
FT                   /note="type 2 and 4; alternatively spliced"
FT   mRNA            join(1..128,1556..1741,3327..5124)
FT                   /product="mucus-type core 2
FT                   beta-1,6-N-acetylglucosaminyltransferase"
FT                   /note="type 1 and 3; alternatively spliced"
FT   CDS_pept        3378..4700
FT                   /codon_start=1
FT                   /product="mucus-type core 2
FT                   beta-1,6-N-acetylglucosaminyltransferase"
FT                   /note="glycosyltransferase"
FT                   /db_xref="GOA:Q7YQE1"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7YQE1"
FT                   /protein_id="AAP76328.1"
FT                   /translation="MKMTGWKKKLCRGHHLWALGCYMLLAVVALRLSLRLKCDVDSLDL
FT                   ESRDFQSQRCRDVLYKNLKLPAKRSINCSGITRGDQEAVVQALLDNLEVKKKRLPFTDT
FT                   YYLNITRDCEQFKAQRKFIQFPLSKEELDFPIAYSMVVHEKIENFERLLRAVYAPQNIY
FT                   CVHVDVKSPETFKEAVKAIISCFPNVFMASKLVPVVYASWSRVQADLNCMEDLLQSSVP
FT                   WKYLLNTCGTDFPIKTNAEMVLALKMLNGKNSMESEIPSEYKKNRWKYRYEVTDRLYLT
FT                   SKMKDPPPDNLPMFTGNAYFVASRAFVQHVLENPKSQRLIEWVKDTYSPDEHLWATLQR
FT                   APWMPGSVPYHPKYHISDMTAIARLVKWQGHEGDVSMGAPYAPCSGIHQRAICIYGAGD
FT                   LHWILQNHHLLANKFDPRVDDNVLQCLEEYLRHKAIYGTEL"
XX
SQ   Sequence 5124 BP; 1311 A; 1140 C; 1187 G; 1486 T; 0 other;
     gctgtggcca ttcctttacg tgcctgcact gaatccggtt aacagtaacg gaggacagag        60
     acactaggct cttcaggaga ggtctggatc tcaggcaaag aggatctcca ctgagctcag       120
     tgacccaggt accatctgct tagagttgcc atctcagagg tctgagttgc tccttattgg       180
     cacccctctt ccccaattct caagtaaaca gttcctaagt atctccctcc ttccagcaat       240
     tgctgctgct gctgccaagt cgcttcagtc gtgtctgact ctgtgcaacc ccacagacgg       300
     cagcccacca ggctcccctg tccctgggat cctccaggca agaacatggg agtgggttgc       360
     cattttcttc tccaatgcgt ggaagtgaaa agtgaaagtg aagttgctca gtcgtgtccg       420
     actcttagcg accccatgga ctgcagccta ccaggctcct ctgtccatgg gattttccag       480
     gcaagagtac tggagtgggg tgccatcgcc ttctctggca attgctactt ccctaataat       540
     ttagcatcga ctatccctcc cctgactttc acttacttac ttgataccta gttaaattct       600
     ttccatgcaa ttattaatat taaatttgct atttcaaaca tttgatgagg aatgctgcgt       660
     ttttggagaa gtggcttgag ggtgagagag acaaagagtg gcaagcaatg tgagcagttt       720
     tttgtttttt cttgggtgtg gcatatgagg atcttagttc cctacctaga aattgaacct       780
     gtgcccccta ctttgggagg tcatagtgtt aaccactgga ccatcaggga aaaacctgtc       840
     agcaaagtcc ctgccagcag ttttgaagga ggcatttttc acactgtatt gacaaaacca       900
     tctatgactt tcttggcgtt atcctttgtt cagactgcca agaaccctag agtctcaaac       960
     attagtgagg gagatctaca atttggaacc tcaaggatct ttctacagcc taaagattat      1020
     taacagtcat ggaaaagcaa atggattttt tgtttgtttt atttttttga gaagtttcca      1080
     tgaaagaaca aactctgttt tttacttact tttccccttc aaataaaaca acaaaagaaa      1140
     caactttgaa ggtcattttt attgcttcag tctttttttt tttttttttg cttcagtctt      1200
     cagggaacgt aaggggagta atatctgatc tccaggtcaa aagaaggcga gggcacacct      1260
     gtatgtgttc atggttcctt gttaggaggg aaaaaagctt tcgggttctt gcatgagtat      1320
     tgacaagtta tgaatgattt tgcagcagga gagcatggct acaaactgga ctgttccgga      1380
     tcaaaaagct gcttgccttc tcagacattg ccagcatttt tttctgcttg ctcacctccc      1440
     tcagtgactt gttcttgaaa atatgaccct gaatgatata tctgagcttg ctctcttatc      1500
     tgagagcagg aagccaggtg agtgacggag gcacctgctg gtctttactt tacagagatt      1560
     aagggaggag cctgccacag tctcttggat gtcctgtgga agttagaaaa catattctgg      1620
     agaggctgaa aggagaccag gagatatggt gttcatgttc gcttccatag aacccgaccc      1680
     ttggaaaaag aaacacaccg tggcaataga tcttccctag ataggacaga agcgattaaa      1740
     ggtgagtttt ctttattgtt catttttcct tcctcttaga tttccataag ttatccctca      1800
     agtggataca atcttatgca tcaaaggaga ttgtgataag ggaaaagagt tattgctgga      1860
     aggatatgtc acattttgtt tctctttctc accttttagg aatttttccc cccctatagt      1920
     atctggtttt ctttggtact aagtatccta gtgattcaaa tagacattta aatacatact      1980
     ttttcatatt ctttttcgtt atgttttgtc acaggatatt gaatatagtt ccctgtactg      2040
     tatataggac cttgtttatt tttttaccta gtaatttcta agtatcctgt attatattta      2100
     aaatgtaact gtggtggagg aacaagaatc aagcttacag acacacacac acacacacac      2160
     acacgcacgc acacaaactg ggggggacca gggaatatgg atgagtccca gatttgcttc      2220
     ttataagtat gtggtatttg gcaagttatt tagcttctgt tttcctctct ataaaagagg      2280
     cttaataata ctgtgtctta agcacgttgt gaagatccaa caggacaacg taaagaaata      2340
     cttctgactc atagaaagca ctcattaaat actgatatgc atagctccgt gtgtctctgt      2400
     gtgtggatgg ttgagtcgca aagtcgtgtc tgactcttgc gaccccaggg actgtagcct      2460
     gccgggctcc tctgtccatg gaattctcca ggcaagaata ctggagtggg ttgccatttc      2520
     cttctccatg tgtgtagata tattttattt atctatgttt ggcctcactg tgcagcatgt      2580
     gggatattag ttctacaacc agggattgaa cctgcatcca ctgcctttga agcgtgaagt      2640
     cttaactact ggaccaccag gaaagtccct ggatagactg taaatctgag tcggctgaga      2700
     gttatctata tgaataacta caatgtattt ttggaattat gttcaatttt ttgtacttgt      2760
     ttaagaacat tttctttaaa gcatggctaa atgctatatc taaccagtga attatgtgtg      2820
     gtgaaagcat ctaaaatatg aactgtcaaa taagaccaag aagtgaactt tatcttttaa      2880
     aagcactttg gatttctaga actgaaggtg agagtatgaa cttcctgtct tttctgtcta      2940
     gaccaatcac aaattctgtc ctccagataa aagctatttt agacacaggg tggtaaggtg      3000
     tgggcagaag tcctctcttc cttggaataa agggtgggga cttcctctta ctcagtactc      3060
     ctccacaaca gcaggtaccc agggctgctt ccttttctct ttcccgggtg gaggtggagc      3120
     cagtcctaac tccagtccca gcatgatcag ctggtttgca gcatcaggtt acagatctcc      3180
     atccacaagg gtcctaggca ggacttgact gaggatattt gtctagagaa gaaatctatc      3240
     tttgccatca ctctggagtt gaacttgatg ttccttgagg atgttccgga ttagtttgta      3300
     actaaaggca ttttgttctg tccaaggatc tcctcctcca ccttccctgt gcccaaactc      3360
     tactgatctc ccatcccatg aagatgactg ggtggaagaa gaagctttgc cgggggcatc      3420
     atctgtgggc tctgggctgc tatatgctgc tggccgttgt tgctctgagg ctttctctca      3480
     ggttgaaatg tgatgtagat tccttggatc tggagtccag ggacttccaa agtcagcgtt      3540
     gtagggacgt cttgtacaag aacctgaagc tgccagcaaa gagatccatc aactgttctg      3600
     ggatcacacg aggggaccag gaagcggtgg tccaggctct cctggacaac ctggaagtca      3660
     agaagaagcg gttgcctttc actgacacct attacctcaa cataaccaga gactgtgagc      3720
     agtttaaggc ccaaaggaag ttcatacagt tcccactgag caaagaagag ttagacttcc      3780
     ccattgcata ctcgatggtg gtccatgaga agattgaaaa ctttgaacgg ctgctgcgag      3840
     ctgtgtatgc ccctcagaac atatactgtg tccatgtgga tgtgaagtcc ccagaaactt      3900
     tcaaagaggc agtcaaggcc attatttcct gcttccccaa tgtcttcatg gccagtaagt      3960
     tggtcccagt ggtttatgcc tcctggtcca gagtgcaggc tgacctgaac tgtatggaag      4020
     acttgctcca gagctcggtg ccatggaaat acttactgaa tacatgtggg acagacttcc      4080
     ccataaagac caacgccgag atggttctgg ccctcaagat gttgaatggg aagaacagta      4140
     tggagtctga gataccttct gagtacaaaa aaaatcgctg gaaataccgc tatgaggtga      4200
     cagacagact gtacctaacc agcaagatga aggaccctcc ccctgataat ttacctatgt      4260
     tcacggggaa tgcctatttt gtggcttctc gagcctttgt ccaacatgtc ttagagaacc      4320
     ccaaatccca aagactgatt gaatgggtca aagacaccta tagccccgac gaacacctct      4380
     gggccaccct tcagcgtgct ccatggatgc ctggctctgt tccttaccac cccaagtatc      4440
     acatctcaga catgactgcc atcgccaggc tggtcaagtg gcagggccac gagggagatg      4500
     tcagcatggg ggcgccttat gcaccctgct ctggaatcca tcagcgggcc atctgcattt      4560
     acggggccgg ggacctgcac tggattctcc agaaccatca cctcttggca aacaagtttg      4620
     acccaagggt ggatgataac gtcctgcagt gcttagaaga gtatttacgt cataaggcca      4680
     tctatgggac tgaactttga gctgtactgt gggcggatcg ctacccaagg gccagggaca      4740
     tgtgccaaca tgcccagggc gtactggtac tgtgtggggt gggggacgag ggctgtggaa      4800
     ttcatggcat cccccagggt cagagggctg cttttggagt gtggagagta gatatgctga      4860
     cttgcagact gcttccctgg gtgaacactg actcagccca cttccaatag ctccttcaca      4920
     cactttctcg ctgagttcat aatacgaacc agctgtctgg gcaagtgtgg gaggagaccc      4980
     tggatttcag ttgaattggt attgagtttt ccactctcta gaggtgccca ttcctaataa      5040
     ttctaggctt ggtagtgggg aggggacttt gatggacaga aggcttctgt tttgtactat      5100
     taacttaata aatagctttt gatt                                             5124
//

If you have problems or comments...

PBIL Back to PBIL home page