(data stored in ACNUC4474 zone)

EMBL: AY295876

ID   AY295876; SV 1; linear; mRNA; STD; VRT; 1323 BP.
XX
AC   AY295876;
XX
DT   11-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Takifugu rubripes nicotinic acetylcholine receptor alpha 1b subunit mRNA,
DE   partial cds.
XX
KW   .
XX
OS   Takifugu rubripes (torafugu)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata;
OC   Eupercaria; Tetraodontiformes; Tetradontoidea; Tetraodontidae; Takifugu.
XX
RN   [1]
RP   1-1323
RX   DOI; 10.1016/S0888-7543(03)00153-8.
RX   PUBMED; 13679024.
RA   Jones A.K., Elgar G., Sattelle D.B.;
RT   "The nicotinic acetylcholine receptor gene family of the pufferfish, Fugu
RT   rubripes";
RL   Genomics 82(4):441-451(2003).
XX
RN   [2]
RP   1-1323
RA   Jones A.K., Elgar G., Sattelle D.B.;
RT   ;
RL   Submitted (12-MAY-2003) to the INSDC.
RL   Human Anatomy and Genetics, University of Oxford, South Parks Road, Oxford
RL   OX1 3QX, UK
XX
DR   MD5; b13b95e8df84469afcad2994abf49573.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1323
FT                   /organism="Takifugu rubripes"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:31033"
FT   CDS_pept        <1..1323
FT                   /codon_start=1
FT                   /product="nicotinic acetylcholine receptor alpha 1b
FT                   subunit"
FT                   /db_xref="GOA:Q7T2W4"
FT                   /db_xref="InterPro:IPR002394"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="InterPro:IPR036719"
FT                   /db_xref="InterPro:IPR036734"
FT                   /db_xref="UniProtKB/TrEMBL:Q7T2W4"
FT                   /protein_id="AAP51164.1"
FT                   /translation="AAPGASKDETRLVKTLFTGYNKVVRPVTHFKDPVVVTVGLQLIQL
FT                   INVDEVNQIVSSNVRLKQQWKDVNLQWNPDDYGGIKKIRVPSTDIWRPDLVLYNNADGD
FT                   FAIVHETKVLLEHTGMITWNPPAIFKSYCEIIVLHFPFDLQNCSMKLGTWTYDGNLVVV
FT                   NPDSDRPDLSNFMESGEWVMKDFRGWKHWVYYACCPDTPYLDITYHFLMLRLPLYFIVN
FT                   VIIPCMLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGK
FT                   YMLFTMVFVIASIIITVIVINTHHRSPSTHTMPEWVRTVFIETIPNIMFFSTMKRPGKE
FT                   KQNKSIQPADFDISEISGNQATAVPYQTSLTKNPDVRSAIEGVKYIAETMKSDEESNNA
FT                   AEEWKFVAMVLDHILLCVFMAVCLIGTLGVFAGRLIELSML"
XX
SQ   Sequence 1323 BP; 313 A; 373 C; 316 G; 321 T; 0 other;
     gcggcgcctg gggcctcgaa ggatgaaact cgtctggtca aaaccctctt cactggctac        60
     aacaaggtgg ttcgtccagt tacacacttc aaggacccgg tggtggttac tgtgggcctg       120
     cagctcatcc agctcatcaa cgtggacgag gttaaccaga tcgtcagcag caacgtgaga       180
     ctcaagcagc aatggaaaga tgtgaacctg cagtggaacc cagatgatta cggtggcatt       240
     aaaaagatca gagttccttc tactgacatt tggaggcctg atctagttct ctacaacaat       300
     gccgatggtg actttgccat cgtccatgag accaaagtgc tgctggagca cacgggcatg       360
     atcacctgga accctcctgc catcttcaaa agctactgtg aaatcattgt actgcacttc       420
     ccttttgacc tccaaaattg cagtatgaag ctgggaacct ggacctacga cggaaacctg       480
     gtcgttgtca atccagacag cgatcgccct gatctgagta acttcatgga aagtggagaa       540
     tgggtgatga aggactttcg tggatggaag cactgggtgt actatgcctg ctgcccagac       600
     accccttacc tggacatcac ctaccacttc ctcatgctgc ggctgccact gtacttcatt       660
     gtcaacgtca tcatcccctg tatgctcttc tccttcctca cgggcctcgt cttctacctc       720
     cccactgatt ctggggagaa gatgactctc agcatctctg tgctgctgtc tctgaccgtg       780
     ttcctgctgg tcatcgtgga gctcatcccc tcgacctcca gcgcggtgcc tctcatcggg       840
     aagtacatgc tgttcaccat ggtgttcgtc atcgcctcca tcatcatcac cgtcatcgtc       900
     atcaacaccc accatcgctc tcccagcact cacacaatgc ctgagtgggt ccgcacggtt       960
     tttatagaga ccatccccaa catcatgttc ttttccacga tgaagcgccc cgggaaggaa      1020
     aagcagaata aaagcatcca acctgctgat ttcgacatct ctgaaatctc aggcaatcag      1080
     gcgacagctg tcccctacca gaccagccta accaaaaatc ctgacgtccg cagcgccatc      1140
     gagggagtca aatacattgc agaaaccatg aaatcagatg aggagtctaa caatgctgct      1200
     gaagagtgga agtttgtggc catggtgctg gaccacattc tgctgtgcgt gttcatggct      1260
     gtgtgtctca ttggaacact gggtgtgttt gcaggtcggc tcattgagct gagcatgctg      1320
     tga                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page