(data stored in ACNUC7421 zone)

EMBL: AY305378

ID   AY305378; SV 1; circular; genomic DNA; STD; PRO; 452156 BP.
XX
AC   AY305378;
XX
PR   Project:PRJNA13603;
XX
DT   16-JUL-2003 (Rel. 76, Created)
DT   02-AUG-2013 (Rel. 117, Last updated, Version 4)
XX
DE   Ralstonia eutropha H16 megaplasmid pHG1, complete sequence.
XX
KW   .
XX
OS   Cupriavidus necator H16
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Cupriavidus.
OG   megaplasmid pHG1
XX
RN   [1]
RP   1-452156
RX   DOI; 10.1016/S0022-2836(03)00894-5.
RX   PUBMED; 12948488.
RA   Schwartz E., Henne A., Cramm R., Eitinger T., Friedrich B., Gottschalk G.;
RT   "Complete nucleotide sequence of pHG1: a Ralstonia eutropha H16 megaplasmid
RT   encoding key enzymes of H(2)-based ithoautotrophy and anaerobiosis";
RL   J. Mol. Biol. 332(2):369-383(2003).
XX
RN   [2]
RP   1-452156
RA   Schwartz E., Henne A., Cramm R., Eitinger T., Friedrich B., Gottschalk G.;
RT   ;
RL   Submitted (23-MAY-2003) to the INSDC.
RL   Biologie, Mikrobiologie, Humboldt-Universitaet zu Berlin, Chausseestr. 117,
RL   Berlin 10115, Germany
XX
DR   MD5; 46ee469569f342062983e66275964996.
DR   EnsemblGenomes-Gn; EBG00001193275.
DR   EnsemblGenomes-Gn; EBG00001193276.
DR   EnsemblGenomes-Tr; EBT00001771545.
DR   EnsemblGenomes-Tr; EBT00001771546.
DR   EuropePMC; PMC2747907; 19648235.
DR   EuropePMC; PMC2832525; 20061479.
DR   EuropePMC; PMC4702634; 26452553.
DR   EuropePMC; PMC4974937; 27547572.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF01757; sbcD.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   StrainInfo; 122962; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..452156
FT                   /organism="Cupriavidus necator H16"
FT                   /plasmid="megaplasmid pHG1"
FT                   /strain="H16"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:381666"
FT   gene            115..1197
FT                   /gene="hoxK"
FT                   /locus_tag="PHG001"
FT   CDS_pept        115..1197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxK"
FT                   /locus_tag="PHG001"
FT                   /product="membrane-bound [NiFe] hydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PHG001"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85757"
FT                   /db_xref="GOA:P31892"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="PDB:3RGW"
FT                   /db_xref="PDB:4IUB"
FT                   /db_xref="PDB:4IUC"
FT                   /db_xref="PDB:4IUD"
FT                   /db_xref="PDB:4TTT"
FT                   /db_xref="PDB:5D51"
FT                   /db_xref="PDB:5MDJ"
FT                   /db_xref="PDB:5MDK"
FT                   /db_xref="PDB:5MDL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31892"
FT                   /protein_id="AAP85757.1"
FT                   /translation="MVETFYEVMRRQGISRRSFLKYCSLTATSLGLGPSFLPQIAHAME
FT                   TKPRTPVLWLHGLECTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAAAGHQAEAILE
FT                   EIMTKYKGNYILAVEGNPPLNQDGMSCIIGGRPFIEQLKYVAKDAKAIISWGSCASWGC
FT                   VQAAKPNPTQATPVHKVITDKPIIKVPGCPPIAEVMTGVITYMLTFDRIPELDRQGRPK
FT                   MFYSQRIHDKCYRRPHFDAGQFVEEWDDESARKGFCLYKMGCKGPTTYNACSTTRWNEG
FT                   TSFPIQSGHGCIGCSEDGFWDKGSFYDRLTGISQFGVEANADKIGGTASVVVGAAVTAH
FT                   AAASAIKRASKKNETSGSEH"
FT   gene            1236..3092
FT                   /gene="hoxG"
FT                   /locus_tag="PHG002"
FT   CDS_pept        1236..3092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxG"
FT                   /locus_tag="PHG002"
FT                   /product="membrane-bound [NiFe] hydrogenase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PHG002"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85758"
FT                   /db_xref="GOA:P31891"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="PDB:3RGW"
FT                   /db_xref="PDB:4IUB"
FT                   /db_xref="PDB:4IUC"
FT                   /db_xref="PDB:4IUD"
FT                   /db_xref="PDB:4TTT"
FT                   /db_xref="PDB:5D51"
FT                   /db_xref="PDB:5MDJ"
FT                   /db_xref="PDB:5MDK"
FT                   /db_xref="PDB:5MDL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31891"
FT                   /protein_id="AAP85758.1"
FT                   /translation="MSAYATQGFNLDDRGRRIVVDPVTRIEGHMRCEVNVDANNVIRNA
FT                   VSTGTMWRGLEVILKGRDPRDAWAFVERICGVCTGCHALASVRAVENALDIRIPKNAHL
FT                   IREIMAKTLQVHDHAVHFYHLHALDWVDVMSALKADPKRTSELQQLVSPAHPLSSAGYF
FT                   RDIQNRLKRFVESGQLGPFMNGYWGSKAYVLPPEANLMAVTHYLEALDLQKEWVKIHTI
FT                   FGGKNPHPNYLVGGVPCAINLDGIGAASAPVNMERLSFVKARIDEIIEFNKNVYVPDVL
FT                   AIGTLYKQAGWLYGGGLAATNVLDYGEYPNVAYNKSTDQLPGGAILNGNWDEVFPVDPR
FT                   DSQQVQEFVSHSWYKYADESVGLHPWDGVTEPNYVLGANTKGTRTRIEQIDESAKYSWI
FT                   KSPRWRGHAMEVGPLSRYILAYAHARSGNKYAERPKEQLEYSAQMINSAIPKALGLPET
FT                   QYTLKQLLPSTIGRTLARALESQYCGEMMHSDWHDLVANIRAGDTATANVDKWDPATWP
FT                   LQAKGVGTVAAPRGALGHWIRIKDGRIENYQCVVPTTWNGSPRDYKGQIGAFEASLMNT
FT                   PMVNPEQPVEILRTLHSFDPCLACSTHVMSAEGQELTTVKVR"
FT   gene            3158..3892
FT                   /gene="hoxZ"
FT                   /locus_tag="PHG003"
FT   CDS_pept        3158..3892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxZ"
FT                   /locus_tag="PHG003"
FT                   /product="membrane-bound hydrogenase-linked b-type
FT                   cytochrome"
FT                   /function="electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PHG003"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85759"
FT                   /db_xref="GOA:P31898"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31898"
FT                   /protein_id="AAP85759.1"
FT                   /translation="MSTKMQADRIADATGTDEGAVASGKSIKATYVYEAPVRLWHWVNA
FT                   LAIVVLAVTGFFIGSPPATRPGEASANFLMGYIRFAHFVAAYIFAIGMLGRIYWATAGN
FT                   HHSRELFSVPVFTRAYWQEVISMLRWYAFLSARPSRYVGHNPLARFAMFFIFFLSSVFM
FT                   ILTGFAMYGEGAQMGSWQERMFGWVIPLLGQSQDVHTWHHLGMWFIVVFVIVHVYAAIR
FT                   EDIMGRQSVVSTMVSGYRTFKD"
FT   gene            3899..4204
FT                   /locus_tag="PHG004"
FT   CDS_pept        3899..4204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG004"
FT                   /product="unknown"
FT                   /note="Orf4; component of membrane-bound hydrogenase gene
FT                   cluster"
FT                   /db_xref="EnsemblGenomes-Gn:PHG004"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85760"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32757"
FT                   /protein_id="AAP85760.1"
FT                   /translation="MQPKRSQAFVDTMHPLPEVLPSVWWHPGVSRRVSVHSGCFLSSHY
FT                   LKPLGLSQPHARCLLRIAKRRLHEIINWNSRQAWKGACSSFRVSVARRTVHGSLFR"
FT   gene            4282..4890
FT                   /gene="hoxM"
FT                   /locus_tag="PHG005"
FT   CDS_pept        4282..4890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxM"
FT                   /locus_tag="PHG005"
FT                   /product="putative protease"
FT                   /function="membrane-bound hydrogenase C-terminal
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:PHG005"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85761"
FT                   /db_xref="GOA:P31909"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004419"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31909"
FT                   /protein_id="AAP85761.1"
FT                   /translation="MVVAMGIGNVLWADEGFGVRCIETLQQRYQFAPQVCLVDGGTQGL
FT                   YLIHHVQAASRLLIFDAIDYGLPPGTLRIIEDEAVPKFLGAKKMSLHQTGFQEVLLLAQ
FT                   LTGQYPQQVVLIGCQPEELEDYGGSLRRVMKAAVEDAVEKGADLLRRWGGMPVPRTAEL
FT                   APAEAVTVPHLALDRYEAERPSPRAACRIGDERFMPQDL"
FT   gene            4900..5223
FT                   /gene="hoxL"
FT                   /locus_tag="PHG006"
FT   CDS_pept        4900..5223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxL"
FT                   /locus_tag="PHG006"
FT                   /product="HoxL"
FT                   /function="membrane-bound hydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG006"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85762"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31899"
FT                   /protein_id="AAP85762.1"
FT                   /translation="MCIGIPMQVMAIEPGYAVCAGRGERRRVSSALVGDCQQGDWLLVF
FT                   LDSARERIDALRAHEIDATLDMLQAALLGLDASEAQPRFELPSAMAREDLAVLSNSRDS
FT                   SSY"
FT   gene            5234..5719
FT                   /gene="hoxO"
FT                   /locus_tag="PHG007"
FT   CDS_pept        5234..5719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxO"
FT                   /locus_tag="PHG007"
FT                   /product="HoxO"
FT                   /function="membrane-bound hydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG007"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85763"
FT                   /db_xref="InterPro:IPR010893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31910"
FT                   /protein_id="AAP85763.1"
FT                   /translation="MSTESAMFLAPIPTTDAVPPVIERLVEQHQAAWVDQDSIDDWLAG
FT                   GGDCVLFIAGDPVRFPECVDVAVVLPELQRVFFNGFRIGVAKREREHEDVLANRFGTQR
FT                   RPSLVFLRDGAYVSVIAGMRDWDEYVREVRRALAMPTSRPPSIGIPVISAAAGGSCH"
FT   gene            5751..6599
FT                   /gene="hoxQ"
FT                   /locus_tag="PHG008"
FT   CDS_pept        5751..6599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxQ"
FT                   /locus_tag="PHG008"
FT                   /product="HoxQ"
FT                   /function="membrane-bound hydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG008"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85764"
FT                   /db_xref="InterPro:IPR006894"
FT                   /db_xref="InterPro:IPR038527"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31911"
FT                   /protein_id="AAP85764.1"
FT                   /translation="MNSFPIPVVLLGPGSQAEDETLDYIHMPQGMSVYTPPVLPEPEQI
FT                   ACLTQAQSVLRAILDALDRADPKQPNPRIELWALDEENRQLLKQVLGEGEVSARIEGEY
FT                   QVYIQEAVFAGVWRVVSTCPDATTDYIEVGAAPEVLRGAARYGANQWSLDVGRVPDGVM
FT                   NAPSILAEIDDQLLSWHPGKPVHVVNLTLLPMSPQDITFLDETLGAASVTILSRGYGNC
FT                   RISSTAVPYCWRVVYFNSQDTTILNTVEITDLPEVACAAPEDLRDSHERLTEVLKWVGS
FT                   I"
FT   gene            6596..6832
FT                   /gene="hoxR"
FT                   /locus_tag="PHG009"
FT   CDS_pept        6596..6832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxR"
FT                   /locus_tag="PHG009"
FT                   /product="putative rubredoxin"
FT                   /function="membrane-bound hydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG009"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85765"
FT                   /db_xref="GOA:P31912"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31912"
FT                   /protein_id="AAP85765.1"
FT                   /translation="MNDAGMGRFEGSYLGDRGRLAADARLECKICWWEYDPEVGDPVWQ
FT                   IAPGTSFSALPAHWRCPNCDGEAEQFMVLGPQA"
FT   gene            6845..7384
FT                   /gene="hoxT"
FT                   /locus_tag="PHG010"
FT   CDS_pept        6845..7384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxT"
FT                   /locus_tag="PHG010"
FT                   /product="HoxT"
FT                   /function="membrane-bound hydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG010"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85766"
FT                   /db_xref="InterPro:IPR023994"
FT                   /db_xref="InterPro:IPR038530"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31913"
FT                   /protein_id="AAP85766.1"
FT                   /translation="MLLANYGACEVDRVRHLEEAFCCIAATRMADIPVVNRALSVEALG
FT                   FEQCAESAGGSDGEMGILITPWFMNLIWLAPYGPCLGERDASTLPVGKTCMRRFGSHDF
FT                   EFIGASEPQFGPYQFCSLFSPMFEFANQASARATATEVLRLLRASPDAPLPPTCAPHRD
FT                   RRGFLFGRRRIEGESL"
FT   gene            7381..8532
FT                   /gene="hoxV"
FT                   /locus_tag="PHG011"
FT   CDS_pept        7381..8532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxV"
FT                   /locus_tag="PHG011"
FT                   /product="HoxV"
FT                   /function="membrane-bound hydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG011"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85767"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31914"
FT                   /protein_id="AAP85767.1"
FT                   /translation="MTRAVALTGRLTFRPGQVPGIAGERPQLAERLLRGRPGEAAPHLL
FT                   PRLFALCGEAHGVTAALAVNAALGRVAAPEPALFRRLAHETACEHIRRIWLDWPLHLAS
FT                   GPVPSTFNSRVPQRELIDCPMLKASHSESAAMLAWLERAVLGTAPRRWLAHWHEDPAGC
FT                   LSTWATKIHTWPAMAMRQCMQVAQAMASMPAPLLPHASTDALRELAQSLAGEADFPCRP
FT                   SWQGRVFETGSWTRLGLADCSAFGNMWLRLGARIAELVLLSLRDGMQASGEAHDSPCLQ
FT                   MGALALAPGQALAWSEMARGLLMHWVRLVDTPQGPVIGGYRIIAPTEWNFHPDGAVAHM
FT                   LAHLAPFDAADVRRSIGILVAAYDPCVPYTVEFAESLGDTVHA"
FT   gene            8525..8884
FT                   /gene="hypA1"
FT                   /locus_tag="PHG012"
FT   CDS_pept        8525..8884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypA1"
FT                   /locus_tag="PHG012"
FT                   /product="HypA1"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /db_xref="EnsemblGenomes-Gn:PHG012"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85768"
FT                   /db_xref="GOA:P31901"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31901"
FT                   /protein_id="AAP85768.1"
FT                   /translation="MHELSLAGGILQLLEDAARRERFARVTLLRLEAGKLCGVEVRALR
FT                   FALEAIASGTCLEGACIEIEEPEGQAWCLQCNAAVALAERGAPCSGCGGYRLQPTAGTE
FT                   LRVMDMLVEDHWCPE"
FT   gene            8947..10032
FT                   /gene="hypB1"
FT                   /locus_tag="PHG013"
FT   CDS_pept        8947..10032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypB1"
FT                   /locus_tag="PHG013"
FT                   /product="HypB1"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /db_xref="EnsemblGenomes-Gn:PHG013"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85769"
FT                   /db_xref="GOA:P31902"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31902"
FT                   /protein_id="AAP85769.1"
FT                   /translation="MCVICGCNTNHETARQDENKGEHAPGRGLVDTGTEPPGAAHVRID
FT                   ASTGDLHYGAGPAHVSVPGLSQARAIKLEQDVLGHNNRLAAHNRQHFVAHGVLALNLVS
FT                   SPGSGKTTLLCTTIEALRRCRADLQLAVIEGDQQTSHDAERIRATGVPAIQINTGKGCH
FT                   LDALMVANAYERLPLHAAAHAHTHEHRQEDGQHSHHHDHEHARHDHHDHRSSGIGSVLF
FT                   IENVGNLVCPAMWDLGESAKVAILSVTEGEDKPLKYPDMFAAASLMILNKIDLLPHLRF
FT                   DVARCIEYARQVNPHLQVLQLSAATGEGVDEWLDWMLAGGAAAGAAAATDGARMRIAAP
FT                   EAGIAALGTQLAPGPAVSKEM"
FT   gene            10034..11218
FT                   /gene="hypF1"
FT                   /locus_tag="PHG014"
FT   CDS_pept        10034..11218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypF1"
FT                   /locus_tag="PHG014"
FT                   /product="HypF1"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /db_xref="EnsemblGenomes-Gn:PHG014"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85770"
FT                   /db_xref="GOA:P45805"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45805"
FT                   /protein_id="AAP85770.1"
FT                   /translation="MRAQTLPAGSDHAPVLACGAWLKNAACLLRGAEVLWSPIHGDLGD
FT                   PANCDALDQSVEQLLDSAHGQVQAVAHDLHPDFYSTQLAQRLAARLCVPAVAVQHHHAH
FT                   IAALMAEYDLREPVIGLALDGVGLGTDGTAWGGELLWVSPSEWCRLGHLQSLPLPGGDV
FT                   AAREPWRMAAAALHVLDRTGEIGRRYGAVVGEQAARTVAAMLERQLNCPRSSSAGRWFD
FT                   AAAGALGVSVRQQAEAQAAIALEALAADYLSALSPPECVGTYVVDQDGVLDLRGLLEQL
FT                   FALADEGQAGQAARGAALFHVALAEALVGWAADAAQGHGLKTVALGGGCFMNGILSASV
FT                   QAGLAARGLQALLPRAVSCGDAGLALGQAWVAARQPTAALAPQTHLQEEGAPCA"
FT   gene            11209..11481
FT                   /gene="hypC1"
FT                   /locus_tag="PHG015"
FT   CDS_pept        11209..11481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypC1"
FT                   /locus_tag="PHG015"
FT                   /product="HypC1"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /db_xref="EnsemblGenomes-Gn:PHG015"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85771"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31900"
FT                   /protein_id="AAP85771.1"
FT                   /translation="MCLAIPARLVELQADQQGVVDLSGVRKTISLALMADAVVGDYVIV
FT                   HVGYAIGKIDPEEAERTLRLFAELERVQPPASEPMHGMNIHQEPA"
FT   gene            11478..12617
FT                   /gene="hypD1"
FT                   /locus_tag="PHG016"
FT   CDS_pept        11478..12617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypD1"
FT                   /locus_tag="PHG016"
FT                   /product="HypD1"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /db_xref="EnsemblGenomes-Gn:PHG016"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85772"
FT                   /db_xref="GOA:P31903"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31903"
FT                   /protein_id="AAP85772.1"
FT                   /translation="MKYIEEFRDGELAQRIAAHVRAEARPGQRYNFMEFCGGHTHAISR
FT                   YGVTELLPENVRMIHGPGCPVCVLPIGRIDLALHLALERDAIVCTYGDTMRVPASGGMS
FT                   LIRAKAHGADIRMVYSAADALKIAQRHPQREVVFLAIGFETTTPPTALIIREAKARQVD
FT                   NFSVLCCHVLTPSAITHILESPEVRDYGTVPIDGFVGPAHVSIVIGTRPYEHFSREYGK
FT                   PVVIAGFEPLDVMQAILMLVRQVNSGRAEVENEFVRAVTRDGNESAQAMVSEVFELRPS
FT                   FEWRGLGEVPYSALRIRAQFARFDAEQRFDLRYRPVPDNKACECGAILRGVKKPTDCKL
FT                   FATVCTPENPMGSCMVSSEGACAAHYSYGRFKDIPLVAA"
FT   gene            12614..13669
FT                   /gene="hypE1"
FT                   /locus_tag="PHG017"
FT   CDS_pept        12614..13669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypE1"
FT                   /locus_tag="PHG017"
FT                   /product="HypE1"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /db_xref="EnsemblGenomes-Gn:PHG017"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85773"
FT                   /db_xref="GOA:P31905"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31905"
FT                   /protein_id="AAP85773.1"
FT                   /translation="MSGTVKLGYQRPLNIKSGRIDMGHGAGGRAAAQLIQELFVAAFDN
FT                   EWLRQGNDQAAFAMPAGARMVMATDAHVVSPLFFPGGDIGSLSVHGTINDVAMAGAKPL
FT                   YLAASFILEEGFPLADLKRIVESMAGAAREAGVPIVTGDTKVVEQGKGDGVFITTTGVG
FT                   VVPAGILIDGAGARPGDAILLSGTMGEHGVAILSKRESLEFDTEIRSDSAALHDLVAQM
FT                   LAVVPGVRVLRDPTRGGLATTLNEISSQSGVGMVLDEAAIPVLPQVDAACELLGLDPLY
FT                   VANEGKLVAICAAADADALLAAMRGHPLGREARRIGEVIEDGRHFVQMRTKFGGMRVVD
FT                   WLSGEQLPRIC"
FT   gene            13681..15474
FT                   /gene="hypX"
FT                   /locus_tag="PHG018"
FT   CDS_pept        13681..15474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypX"
FT                   /locus_tag="PHG018"
FT                   /product="HypX"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /db_xref="EnsemblGenomes-Gn:PHG018"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85774"
FT                   /db_xref="GOA:Q79IP8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR009188"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q79IP8"
FT                   /protein_id="AAP85774.1"
FT                   /translation="MRILLLTHSFNSLTQRLFVELRQRGHLVSVEFDIADSVTEEAVAL
FT                   FAPDLVIAPFLKRAIPERIWSRLVCLVVHPGIVGDRGPSALDWAIVRDERSWGVTVLQA
FT                   NGEMDAGPVWASATFPMRAARKSSLYRNEVTVAAVQAVLEALAAFEAGWRSANDAQSGP
FT                   GTWNPAMRQAERGIDWARESTAAVLAKLHAADSFPGVPDALFGQPCRLFDAHAATPQTV
FT                   ARAPRGQPGDIVARREHAVLRLTVDAGVWIGHAKLAVRDEWENTSLPSLKLPVAQVFHE
FT                   AWAQLPDLSLPLEHDAGEWSEFRYWEDDSGAGLVGYLAFDCYNGAMSTAQCQRLCAALR
FT                   YARGRQTRVLVLLGGEDFFSNGIHLHQIEAAEHRGAESAADASWRNIQAMDDVALEILA
FT                   FSDRMTVSALRGNAGAGGVFLALAADQVWAREGVLVNPHYKNMGNLYGSEYWTYLLPQR
FT                   VGAQRASDLMDGRLPMSVRRAIEIGLIDASLDGDARSCLAEIGRRAVALARAPDYAAHI
FT                   DNKRRKRAADEAAKPLAQYREEELVHMHRNFYGFDPSYHVARYHFVYKLPHAHTPRHLA
FT                   MHRGGSLPAAQELQALAGKRS"
FT   gene            15478..16926
FT                   /gene="hoxA"
FT                   /locus_tag="PHG019"
FT   CDS_pept        15478..16926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxA"
FT                   /locus_tag="PHG019"
FT                   /product="HoxA"
FT                   /note="transcriptional activator (NtrC family) of
FT                   hydrogenase genes"
FT                   /db_xref="EnsemblGenomes-Gn:PHG019"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85775"
FT                   /db_xref="GOA:P29267"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P29267"
FT                   /protein_id="AAP85775.1"
FT                   /translation="MSDKQATVLVVDDETRSQDALRRTLDEEFRVLTVSSADEARALLL
FT                   RQPVSVILCDQRMPGLTGVEFLKEVRERWPEIVRIVISGYTDSEDIIAGVNEAGIYQYI
FT                   LKPWVPDHLIDTVRQAVEAQGLQGDMHRLDLELRTSTPVLRQRSSQKLASAQSAFNFER
FT                   IVRAPGSPLDAVCEVAARVARYDLPVMVLGESGTGKELLARAIHYASPRAARAFVSENC
FT                   AAVPDNLLESELFGHKRGAFTGAYEDHAGLFQRANGGTIFLDEIGDTSPAFQVKLLRVL
FT                   QEGEVRPVGSPRWIPVDVRVIAATHCNLESDVHAGRFREDLYYRIAGVTISMPPLRERS
FT                   GDLQPIAAKLLEQVAQELARPGLYFGGDALAAMMAYPWPGNIRELRNEIYRAVALSSGE
FT                   EIRAQLFSRKVLHGQPGTVKRGPHVQTFPQSGTLQERLDAIEAVVLKEALLRHRWNKTH
FT                   AAKELGLSRVGLRQKLLRFGLEEK"
FT   gene            16923..17966
FT                   /gene="hoxB"
FT                   /locus_tag="PHG020"
FT   CDS_pept        16923..17966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxB"
FT                   /locus_tag="PHG020"
FT                   /product="regulatory [NiFe] hydrogenase small subunit"
FT                   /function="hydrogen sensor"
FT                   /db_xref="EnsemblGenomes-Gn:PHG020"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85776"
FT                   /db_xref="GOA:Q79IP7"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:Q79IP7"
FT                   /protein_id="AAP85776.1"
FT                   /translation="MNAPVCTGLASAKPGVLNVLWIQSGGCGGCSMSLLCADTTDFTGM
FT                   LKSAGIHMLWHPSLSLESGVEQLQILEDCLQGRVALHALCVEGAMLRGPHGTGRFHLLA
FT                   GTGVPMIEWVSRLAAVADYTLAVGTCAAYGGITAGGGNPTDACGLQYEGDQPGGLLGLN
FT                   YRSRAGLPVINVAGCPTHPGWVTDALALLSARLLTASDLDTLGRPRFYADQLVHHGCTR
FT                   NEYYEFKASAEKPSDLGCMMENMGCKGTQAHADCNTRLWNGEGSCTRGGYACISCTEPG
FT                   FEEPGHPFHQTPKVAGIPIGLPTDMPKAWFVALASLSKSATPKRVKLNATADHPLIAPA
FT                   IRKTRLK"
FT   gene            17976..19433
FT                   /gene="hoxC"
FT                   /locus_tag="PHG021"
FT   CDS_pept        17976..19433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxC"
FT                   /locus_tag="PHG021"
FT                   /product="regulatory [NiFe] hydrogenase large subunit"
FT                   /function="hydrogen sensor"
FT                   /db_xref="EnsemblGenomes-Gn:PHG021"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85777"
FT                   /db_xref="GOA:Q79IP6"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:Q79IP6"
FT                   /protein_id="AAP85777.1"
FT                   /translation="MERLVVGPFNRVEGDLEVNLEVASGRVCSARVNATMYRGLEQILL
FT                   HRHPLDALVYAPRVCGICSVSQSVAASRALADLAGVTVPANGMLAMNLMLATENLADHL
FT                   THFYLFFMPDFTREIYAGRPWHTDATARFSPTHGKHHRLAIAARQRWFTLMGTLGGKWP
FT                   HTESVQPGGSSRAIDAAERVRLLGRVREFRCFLEQTLYAAPLEDVVALDSEVALWRWHA
FT                   QAPQAGDLRCFLTIAQDAALDQMGPGPGTYLSYGAYPQPEGGFCFAQGVWRSAQGRLDA
FT                   LDLAAISEDATSAWLVDQGGARHPANGLTAPAPDKVGAYTWNKAPRLAGAVLETGAIAR
FT                   QLAGAQPLVRDAVARCGATVYTRVLARLVELARVVPLMEDWLQSLEIGAPYWASAHLPD
FT                   QGAGVGLTEAARGSLGHWVSVRDGRIDNYQIVAPTSWNFSPRDIAGQPGAVEKALEGAP
FT                   VLQGETTPVAVQHIVRSFDPCMVCTVH"
FT   gene            19533..20933
FT                   /gene="hoxJ"
FT                   /locus_tag="PHG022"
FT   CDS_pept        19533..20933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxJ"
FT                   /locus_tag="PHG022"
FT                   /product="histidine protein kinase"
FT                   /function="hydrogen sensing/signal transduction in complex
FT                   with HoxBC"
FT                   /db_xref="EnsemblGenomes-Gn:PHG022"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85778"
FT                   /db_xref="GOA:Q7WXU0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXU0"
FT                   /protein_id="AAP85778.1"
FT                   /translation="MSSKRTTTSSGSHGVDLDAMTPSQLEGIDEATWLDVIRKMDEVYL
FT                   QLIEDEVALEEKNAQLEQSQQFIFSLLSAMSDVLVACNARGEIEETNVALRELVGMQES
FT                   ALHGMSIYQLLADDDSAATLRTVIDNVGPGRSFNVVELNLFDAERSIVPVDVSCTPRIG
FT                   PNGRREGYVFVGRPMAEIKRAYHQLREAHEALKRTQQQLLHAEKMASLGRLVAGVAHEL
FT                   NNPISFVLGNVHALKRYSERLAAYVALLHSGEDGAEAERQRIRLRIDHILQDMPSLIEG
FT                   TLEGAQRTADIVRGLTRFSAVDREEPSVFDLSEVVKRAIHWVKKGTAPTFEVHWSPLPG
FT                   CLVMGSAGHVQQVMMNLIQNAYDAAGSRDDAVPALWIALDRLDDRVVLRFRDNGPGIAA
FT                   EHLARVFDPFFSTKPVGKGTGLSLSISYGIVERHGGRLLVRNHPEGGAEFTVELPAAHD
FT                   KGSSADRR"
FT   gene            21335..22390
FT                   /gene="hoxN1"
FT                   /locus_tag="PHG023"
FT   CDS_pept        21335..22390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxN1"
FT                   /locus_tag="PHG023"
FT                   /product="high-affinity nickel permease"
FT                   /function="nickel uptake"
FT                   /note="NiCoT family; TC 2.A.52"
FT                   /db_xref="EnsemblGenomes-Gn:PHG023"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85779"
FT                   /db_xref="GOA:P23516"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23516"
FT                   /protein_id="AAP85779.1"
FT                   /translation="MFQLLAGVRMNSTGRPRAKIILLYALLIAFNIGAWLCALAAFRDH
FT                   PVLLGTALLAYGLGLRHAVDADHLAAIDNVTRKLMQDGRRPITAGLWFSLGHSSVVVLA
FT                   SVLIAVMATTLQERLDAFHEVGSVIGTLASALFLFAIAAINLVILRSAYRAFRRVRRGG
FT                   IYVEEDFDLLFGNRGFLARIFRPLFRFITRSWHMYPLGMLFALGFDTATEVALLGISTM
FT                   EASRGVPIWSILVFPALFTAGMALIDTIDSILMCGAYAWAYAKPVRKLYYNMTITFVSA
FT                   IVALIVGGIETLGLLADKFMLKGVFWNAVGALNENFCQLGFVIIGIFTVCWVVSIVVYR
FT                   LRRYDDSEVRA"
FT   repeat_region   22855..22858
FT                   /rpt_type=DIRECT
FT   mobile_element  22859..25891
FT                   /mobile_element_type="insertion sequence:IS881"
FT   repeat_region   22859..22874
FT                   /rpt_type=INVERTED
FT   misc_feature    22933..25745
FT                   /note="similar to IS881 transposase"
FT   intron          23467..25305
FT                   /note="group II"
FT   repeat_region   25867..25891
FT                   /rpt_type=INVERTED
FT   repeat_region   25892..25895
FT                   /rpt_type=DIRECT
FT   gene            25947..26612
FT                   /locus_tag="PHG027"
FT   CDS_pept        25947..26612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG027"
FT                   /product="fructose-1,6-bisphosphate"
FT                   /note="sedoheptulose-1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG027"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85780"
FT                   /db_xref="GOA:Q7WXT9"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXT9"
FT                   /protein_id="AAP85780.1"
FT                   /translation="MIPMTQKLTFTRFVIAEQHGSKTVDSDLIALLLDVSIACRKIASS
FT                   IAKGSPLALGGEAAGRDVPGEIQSKTDMATPCFFARSEALARHLAGMASEGMEGAYPVP
FT                   LRSPQGRYLLVCDPLDGSANIDVNVSGGIIFSVLRCPEGISAPEERDLLQAGSAQMAAG
FT                   YALYDAPALLVLKTGSGIHGFTLDADSGQYVLTHPNAKIPQVPAGSRSALRPSTSGQS"
FT   gene            26623..28839
FT                   /locus_tag="PHG028"
FT   CDS_pept        26623..28839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG028"
FT                   /product="putative TonB-dependent outer membrane receptor"
FT                   /note="similar to Ralstonia solanacearum putative outer
FT                   membrane receptor NP_521043"
FT                   /db_xref="EnsemblGenomes-Gn:PHG028"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85781"
FT                   /db_xref="GOA:Q7WXT8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXT8"
FT                   /protein_id="AAP85781.1"
FT                   /translation="MIQCAFKIVMKAVGKNCASGQRPGCRDAPQALAPHCGPCLRRPST
FT                   LAIGVAVSCCAIPHGASIAGGVQQPEAQLRTVTVQGSQAEADATGEAASQGYVTRGQLE
FT                   NRPLLRPRELLETVPGLIVTQHSGDGKANQYFLRGFNLDHGTDLATTVASMPVNMRTHV
FT                   HGQGYTDLNFVIPELVSGIAYKKGTYFAEEGDFSAAGAVRIDYVSSLPQGIAQLELGQH
FT                   GYRRALLADSNQVGPGTLLYGFEWLGENGPWVLPEGVHKLNGVLRYSLPLGGGERLGIT
FT                   AMAYKNAWNSTDQVPQRAIDQGLISRFGHIDPTDGGASSRYSLSADWQRPLQDGQFKAN
FT                   AYMIKSRLQLFSNFTYALNNPERGDQFEQFENRVTTGANASRTWFGTLAGRDTESELGT
FT                   QLRYERLDPITLNNTAARHSYQQVRSDRVNETSAALYLRNTVQWLPWLRTVAGLRADQF
FT                   WYGVSSDNPANSGNGRDHIVSPKLSLVLSPTAKTDVFVNWGRGYHSNDVRGATATVDPS
FT                   TGDPVQKVSVLVPATGCELGVRTGDVLPGLQLSASLWRLNIGSELVFSGDTGTTEPSRP
FT                   SRRTGIELTAYYVPMAGLIIDADAAFSRARFRDHESIGDYIPESIQTTASMGLSANRGR
FT                   WSFGARMRYFGPRPLIEDNSVRSASSFLVNLKLGYRVQKNVRIFAEVLNVLGKRANDID
FT                   YYYASLLKGETFPLDASGAAAGINDHHIHPAEPRTLRVGITWSF"
FT   gene            complement(29266..29595)
FT                   /locus_tag="PHG029"
FT   CDS_pept        complement(29266..29595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG029"
FT                   /product="putative transposase"
FT                   /note="similar to Azotobacter vinelandii gi:23105644"
FT                   /db_xref="EnsemblGenomes-Gn:PHG029"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85782"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXT7"
FT                   /protein_id="AAP85782.1"
FT                   /translation="MARLERALALFMVVAWRIARLMRLGRTCPDLDAGLLFERDEWRAA
FT                   FILNKKKPPKTSPRLNEVVRLVAMLGGFLARKGDGEPGVKTIWQGLQRVVDFAAGLRYA
FT                   RELDD"
FT   gene            complement(29641..29886)
FT                   /locus_tag="PHG030"
FT   CDS_pept        complement(29641..29886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG030"
FT                   /product="putative transposase"
FT                   /note="similar to Ralstonia metallidurans gi:22976888"
FT                   /db_xref="EnsemblGenomes-Gn:PHG030"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85783"
FT                   /db_xref="GOA:Q7WXT6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXT6"
FT                   /protein_id="AAP85783.1"
FT                   /translation="MRSSMSRRGDCWDNAPTESLWGSLKVARLHGRQFATRRAAMDEVI
FT                   DWLGFYNATRLHSTLGYVSPMTFEKNWFAAQQHRAA"
FT   gene            complement(29898..30539)
FT                   /locus_tag="PHG031"
FT   CDS_pept        complement(29898..30539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG031"
FT                   /product="putative transposase"
FT                   /note="similar to Ralstonia metallidurans gi:22976848"
FT                   /db_xref="EnsemblGenomes-Gn:PHG031"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85784"
FT                   /db_xref="GOA:Q7WXT5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXT5"
FT                   /protein_id="AAP85784.1"
FT                   /translation="MKYAFIEQNRRYWPVSVLCELMGVSPSGYHQRKQRTVSTDRPDRG
FT                   RLSDDALLAHIKAIHVGVKGEYGWPRMWKELLARGVRVGKERVRKLMALHGIRARHKRK
FT                   YIATTNSNHDLPVAHNLLQRDFSPAAPNQVWTSDITYVATAEGWLYLVVIIDLFSRQVV
FT                   GWSMQPHMKAELVTDALRMAWFRRRPEAGLIVHTDRLNPPSIAVTCFKTP"
FT   gene            complement(30536..30832)
FT                   /locus_tag="PHG032"
FT   CDS_pept        complement(30536..30832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG032"
FT                   /product="putative transposase"
FT                   /note="OrfA; similar to Ralstonia solanacearum ISRS08
FT                   transposase ORFA protein (NP_518700)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG032"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85785"
FT                   /db_xref="GOA:Q7WXT4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXT4"
FT                   /protein_id="AAP85785.1"
FT                   /translation="MTSKTKRAQYTLEFKLEAVRLVKSGQSMAVVSATLGIRAQTLHNW
FT                   VKAEREGKLTGAGMKPVSPEQMELARLRAEVARLKMERDILKKAAAYFAKESV"
FT   gene            complement(30877..31614)
FT                   /locus_tag="PHG033"
FT   CDS_pept        complement(30877..31614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG033"
FT                   /product="putative transposase"
FT                   /note="similar to Azotobacter vinelandii gi:23106128"
FT                   /db_xref="EnsemblGenomes-Gn:PHG033"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85786"
FT                   /db_xref="GOA:Q7WXT3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXT3"
FT                   /protein_id="AAP85786.1"
FT                   /translation="MDFNGQAIAGLGPLSYEAQRGLYLHPTYAVTPAREPLGVLDAYMW
FT                   AREPKGADGVRPGIKESTRWTEGYERVAEQAAALPATRLVYVADRESDIMALMVKAKEL
FT                   GHPADWLLRSQHNRTLPGGGKLWDQVTAGKPVGRIHFTLAARQAQPARAVRQQVWAQRV
FT                   TLPDAAGGVVSATCIVAREVDPPAGVKPIEWRLLSNREVDDLDAAAQLIDWYRARWEVE
FT                   LFFHVLKNGCRVEALQLALSLPP"
FT   gene            complement(31682..31903)
FT                   /locus_tag="PHG034"
FT   CDS_pept        complement(31682..31903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG034"
FT                   /product="putativa integrase/recombinase"
FT                   /note="similar to Sinorhizobium meliloti putative
FT                   integrase/recombinase, C-terminus (NP_436130))"
FT                   /db_xref="EnsemblGenomes-Gn:PHG034"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85787"
FT                   /db_xref="GOA:Q7WXT2"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXT2"
FT                   /protein_id="AAP85787.1"
FT                   /translation="MSVLQATKDLRKVSLWLGHAHMQTTEIYTRADPSVKLEALEAIVP
FT                   PNLRSGRFKATDELIASLRPGSLMQRKK"
FT   stem_loop       31989..39346
FT                   /note="IR16-1"
FT   stem_loop       31989..35366
FT                   /note="IR16-1"
FT   gene            32075..32299
FT                   /locus_tag="PHG035"
FT   CDS_pept        32075..32299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG035"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Rhizobium sp. NGR234
FT                   integrase/recombinase Y4RA, N-terminus (NC_000914)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG035"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85788"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXT1"
FT                   /protein_id="AAP85788.1"
FT                   /translation="MRYTIHDRVVLARAPDGPLASHIAAFASSIAAQGYSTQSLKYHVR
FT                   LVAGFSRWLGRNGIDLRNVCPDQAARYLR"
FT   gene            32312..33313
FT                   /locus_tag="PHG036"
FT   CDS_pept        32312..33313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG036"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Rhizobium sp. NGR234 putative
FT                   integrase/recombinase Y4RA (NP_444039))"
FT                   /db_xref="EnsemblGenomes-Gn:PHG036"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85789"
FT                   /db_xref="GOA:Q7WXT0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXT0"
FT                   /protein_id="AAP85789.1"
FT                   /translation="MRPGPGDRAALKHLIAFLDRERLIPAQRTPARRLTPVESCTLAYV
FT                   EYLREVRALSKATIINYTPFIREFLEDCFGDRRVRLSRLRAGDVVNFVQFQAQHLHLKR
FT                   AKLMTAALRSFLRYACYRGDMTLDLAAAVPVVANWSMQSIPRGIPPEQIQELLVSIDRR
FT                   TAVGRRDYAIILLLARLGLRSGEVAFLDLDDIDWNTGVLSVRGKSGLRNGLPLPADVGK
FT                   AIAAYLRYGRPQSTSRRVFLRAKAPFTGFRSACGVGSIVRHSLQRAGINAPTTGAHQFR
FT                   HALASQMLRHGASLREIGELLGHHHPQTTSIYTKVDIKALRTLAVPWPGGVR"
FT   gene            33310..34254
FT                   /locus_tag="PHG037"
FT   CDS_pept        33310..34254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG037"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Rhizobium sp. NGR234 putative
FT                   integrase/recombinase Y4RB (NP_444040)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG037"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85790"
FT                   /db_xref="GOA:Q7WXS9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXS9"
FT                   /protein_id="AAP85790.1"
FT                   /translation="MNTLRQAVQEYLDLRRSLGFKLREAGKALPDFVAFMERHRASFIT
FT                   QALALLWAQQPSNVQPARWASRLSIVREFARHRSATDPRTQIPAPGLLPFSPKRARPYL
FT                   YSSDEIRRLLHAALQMPCRFARDELQPWTYYCLFGLLSVSGMRLGEARNLELQDIDLTA
FT                   AILTIRGAKLGKSRFVPLHASTCNVLADYIARRKRHWAGRPVSSYLFVSNQGNRLDSGE
FT                   IHRHFYALSRQIGLRGAADSHGPRLHDMRHVFATNTLLRWYRSGQDPERRLPILSAYLG
FT                   HVHIEDTQWYLNASPELMREAMRRLEQRWEIQP"
FT   gene            34251..35249
FT                   /locus_tag="PHG038"
FT   CDS_pept        34251..35249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG038"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Rhizobium sp. NGR234 putative
FT                   integrase/recombinase Y4RC (NP_444041)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG038"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85791"
FT                   /db_xref="GOA:Q7WXS8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXS8"
FT                   /protein_id="AAP85791.1"
FT                   /translation="MTTTASLAPLLERFFTQRLMQQRQASPHTISSYRDTFRQFLKFAL
FT                   QRLHRQPSRMNFEEIDAPLIVAFLDDLEKRQGVSVRSRNLRLTAIHSFFRYAALETPAH
FT                   SAQIQRVLAIPSKRFTRTLVQFLTRQEVDALLAAPDQRTWSGRRDHAFLLFAVQTGLRL
FT                   SEMTGLKRDDLVLGIGAHVRVIGKGRKERCTPIVRSTLAVLKAWLREPKRGEGDVLFPN
FT                   ARGERLTVHGVQYLLNKHRETASKVCPSLKHKQVTVHRLRHTMAMDLLQAGVDRSVIAL
FT                   WLGHESVETTQIYLEATLAMKEQALAKTSLAQGKPGRYRPADQLLGFLNGL"
FT   stem_loop       35367..35969
FT                   /note="IR16-1"
FT   gene            complement(35731..35931)
FT                   /locus_tag="PHG039"
FT   CDS_pept        complement(35731..35931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG039"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Rhizobium sp. NGR234 putative
FT                   integrase/recombinase Y4RC, C-terminus (NP_444041)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG039"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85792"
FT                   /db_xref="GOA:Q7WXS7"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXS7"
FT                   /protein_id="AAP85792.1"
FT                   /translation="MELLQAGVDPFNIALWMGHESLQTTQIYLDASLELKEKILANVGP
FT                   HDGKPVRYRPDSKLATFLKGL"
FT   stem_loop       35970..39346
FT                   /note="IR16-1"
FT   gene            complement(36086..37084)
FT                   /locus_tag="PHG040"
FT   CDS_pept        complement(36086..37084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG040"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Rhizobium sp. NGR234 putative
FT                   integrase/recombinase Y4RC (NP_444041))"
FT                   /db_xref="EnsemblGenomes-Gn:PHG040"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85793"
FT                   /db_xref="GOA:Q7WRQ5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WRQ5"
FT                   /protein_id="AAP85793.1"
FT                   /translation="MTTTASLAPLLERFFTQRLMQQRQASPHTISSYRDTFRQFLKFAQ
FT                   QRLHRQPSRMNFEEIDAPLIVAFLDDLEQRQGVSVRSRNLRLTAIHSFFRYAALETPAH
FT                   SAQIQRVLAIPSKRFTRTLVQFLTRQEVDALLAAPDQRTWAGRRDHAFLLVAVQTGLRL
FT                   SEMTGLKRDDLVLGTGAHVRVIGKGRKERCTPIVRSTLAVLKAWLREPQRGEDDVLFPS
FT                   ARGERLTVHGVQYLLNKHRETASKICPSLKQKQVTVHRLRHTMAMDLLQAGVDRSVIAL
FT                   WLGHESVETTQIYLEATLAMKEQALAKTSLAHGKPGRYRPADELLGFLNGL"
FT   gene            complement(37081..38025)
FT                   /locus_tag="PHG041"
FT   CDS_pept        complement(37081..38025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG041"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Rhizobium sp. NGR234 putative
FT                   integrase/recombinase Y4RB (NP_444040))"
FT                   /db_xref="EnsemblGenomes-Gn:PHG041"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85794"
FT                   /db_xref="GOA:Q7WXS6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXS6"
FT                   /protein_id="AAP85794.1"
FT                   /translation="MNTLRQAVQEYLDLRRSLGFKLKDAGKALPDFVAFMERHRASFIT
FT                   QALALMWAQQPSNVQPAHWARRLSIVREFARHRSATDPRTQIPAPGLLPFSPKRARPYL
FT                   YSSDEIRRLLHAALQIPCRYARDELQPWTYYCLFGLLSVSGMRLGEARNLELQDIDLTA
FT                   AILTIRGAKLGKSRFVPMHASTCKVLADYIARRKRHWAGRPVSSYLFVSNQGNRLDSGE
FT                   IHRHFYALSRQIGLRGAADSHGPRLHDMRHVFATNTLLRWYRSGQDPERRLPILSAYLG
FT                   HVHIADTQWYLNASPELMREAMRRLEQRWEIQP"
FT   gene            complement(38022..40649)
FT                   /locus_tag="PHG042"
FT   CDS_pept        complement(38022..40649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG042"
FT                   /product="Orf2/integrase/recombinase fusion protein"
FT                   /note="ISAE1 Orf2 fused to putative integrase/recombinase
FT                   similar to Rhizobium sp. NGR234 Y4RA (NP_444039)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG042"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85795"
FT                   /db_xref="GOA:Q7WXS5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXS5"
FT                   /protein_id="AAP85795.1"
FT                   /translation="MSGLCGMRVDRGEVELSGDQEDHGAHGFEAHITAGLALGGLEQAV
FT                   ERLQEAIGLARLGPCNDTVEMLADHARDLLHWLDLGSHDVRAPLLEHCGNNVDLLALKD
FT                   FAQLLAIQPGTGSAFGRDVGDQRVEIGTLRGWQPVAILEQRPAQAFEAWIGLLFDTPGL
FT                   VHGCRSVSHDMELVEGDARVGQMLADALDERRRHVDTDHPDLLRRSVVLAQMCSELANR
FT                   GSILAFGHKHDLTRVGISDKRQVVVTAPVGRFVNGGSGHAGQIEFGHREVDIALADSVH
FT                   AMPRLTHRSGYSRKRHLLRKRHHHGFKQQREARELASPVRLDQHHAAVGKLHAWRADFQ
FT                   IAVVLEEVQVPIAFGHRVVNRVPTGDLRVGKAAAGDKVNLDRQRLGLRVEVDFPDEPRI
FT                   AYAKGCFKQFAMHRSCCSLPETRHDTTHLKFKRGLSISWANGCTEIEIVLTPSFSPRAS
FT                   GKESIMRYTIHDRVVLAHAPEGPLASHIVAFANSIAVQGYSTQSLKYHVRLVAGFSRWL
FT                   GRNGIDLHNVCPDHSAQYLRYRARHVRPGPGDRAALRHLIDFLDRERLISAQRMPERRL
FT                   TPIESCTQAYVEYLHEARALSKATIVNYVPFIREFLEDCFGDGRIRLSRLRAGDVVNFV
FT                   QCQALRLHLKRAKLMTTALRSFLRYACYRGDMTLDLAAAVPVVANWSMQSIPRGIPPEQ
FT                   IQQLLVSINRRTAVGRRDYAIILLLARLGLRSGEVAFLELDDIDWNTGVLSVRGKSGQR
FT                   NGLPLPADVGKAIAAYLRDGRPQSTSRRVFLRAKAPVIGFRGASGVGSIVRHSLQRAGI
FT                   DAPTTGAHQFRHGLACQMLSHGASLSEIGELLGHHHPQTTKIYTKVDIKALRTLAVPWP
FT                   GGVR"
FT   repeat_region   39343..39350
FT                   /rpt_type=DIRECT
FT   mobile_element  39351..40663
FT                   /mobile_element_type="insertion sequence:ISAE1"
FT   repeat_region   39351..39393
FT                   /rpt_type=INVERTED
FT   gene            39414..40640
FT                   /locus_tag="PHG043"
FT   CDS_pept        39414..40640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG043"
FT                   /product="transposase"
FT                   /note="similar to GenBank Accession gi:141951"
FT                   /db_xref="EnsemblGenomes-Gn:PHG043"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85796"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q79IP4"
FT                   /protein_id="AAP85796.1"
FT                   /translation="MHSKLFEAALGISDPWFVREVDFNAQTKTLTIQIDFVAGSRFSHP
FT                   EVAGGHPVHDTVTKRYRHLNFFEHDCYLEVRTPRVKLPDGRVVLVEPDWAGKLSGFTLL
FT                   FEAMVVALAQQMPFSAVARTVGESWHRVYAICERYVDLAVAELDLAGVTAAAVDETSYR
FT                   RGHNYLTLVADADARKVVFVTEGKDAATVGKFAAHLRENNAAPEQIGVVSIDMSPAFIK
FT                   GVSEHLPNARITFDKFHVVAHASAAVDKTRRIEQKTDPSLKGLRWTLLKDRDGLPAAQR
FT                   ADLDALIANVTTKRTARAWLYREQLREILERKQINVVSAMLEQWCTNVMRSKVEPMKEV
FT                   ARMIRKHFDGIVAWTQTRQTNGFLEALNGLFQAAKRKARGYVSFKTMRTVIFLIAGKLD
FT                   FSAINPHAA"
FT   repeat_region   40621..40663
FT                   /rpt_type=INVERTED
FT   gene            complement(40646..41500)
FT                   /locus_tag="PHG044"
FT   CDS_pept        complement(40646..41500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG044"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Rhizobium sp. NGR234 putative
FT                   integrase/recombinase Y4RC (NP_444041)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG044"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85797"
FT                   /db_xref="GOA:Q7WXS4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXS4"
FT                   /protein_id="AAP85797.1"
FT                   /translation="MKSTVGFPSLVQRFFTERLMQQRQASPHTISSYRDTFRLLLRFAY
FT                   KRLHKPPDHLAFEDINAPLVTAFLNDLEKTRAISVRTRNLRLTAIRSFFRYAAFETPAY
FT                   SAQIQRVLSMPNKRYDRRLIHFLTRPEVKALLAAPDKRTWCGRRDHALLRLGVETGLRV
FT                   SEMTGLTREDVTLGAGAHIDVMGKGRKQRVTPFSKETAAILKAWMKEPRTPNSDALFPS
FT                   VRGGHLSPDAVQRLLKKYATQAAMGCPSLRKKRVTPHVLRHYMPFPTMSCNRKIALYGS
FT                   FEK"
FT   repeat_region   40664..40671
FT                   /rpt_type=DIRECT
FT   gene            complement(41497..42429)
FT                   /locus_tag="PHG045"
FT   CDS_pept        complement(41497..42429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG045"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Rhizobium sp. NGR234 putative
FT                   integrase/recombinase Y4RB (NP_444040)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG045"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85798"
FT                   /db_xref="GOA:Q7WXS3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXS3"
FT                   /protein_id="AAP85798.1"
FT                   /translation="MSTLRKSMEEYLTMRRRLGFKLHEAGQRLEDFVCFMERHRASHIS
FT                   ASLALTWAQKSPSVQPVIWAQRLGVVRGFARYLSAFDPHTEIPRAELLPHRYHRRAPYL
FT                   YTDEETQKILAAALALPPESGLRRWTYFTLIGLLSVTGLRPGEAVNLELEDVDLKECVL
FT                   TVRGSKFGKSRWVPIHSSTRDALADYLRRRARCLAGRPETHVFITSQGKPLSGDMVSHT
FT                   FTALTREIGLRDSSAKRAPRLIDYRHLFAVTTLARLDRSGKDPVRWLPVLSTFLGHQWA
FT                   RDTYWYVEQHPELMKQAMKRLERRWKDMS"
FT   gene            complement(42426..43658)
FT                   /locus_tag="PHG046"
FT   CDS_pept        complement(42426..43658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG046"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Rhizobium sp. NGR234 putative
FT                   integrase/recombinase Y4RA (NP_444039)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG046"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85799"
FT                   /db_xref="GOA:Q7WXS2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXS2"
FT                   /protein_id="AAP85799.1"
FT                   /translation="MEKLYQKTRSHSLDTPEGPLAEHLGAFEGLLNDQGYAQESIRRHL
FT                   LLVADFSVWLKCKKMSIEEVTHETAQRYLRYREHHRCHRNGARYAVRRFVQLLQENGIV
FT                   AKEASGAQTPVEKLVNGYSLYLHQERGLAATTIRKYRWCAHLFLTKQFGDGATRLSDLS
FT                   AREIIDFVQHEATQSPGRAQSIAKVLRSFLQYARYRGLIKLDLAAAIPRVAHWSMASIP
FT                   KAISPEYARRALASCDRRRPVGRRDYAILLLLARLGLRSGEVVSLTLDDIDWETGTLNI
FT                   HGKGGQESPLPLLAPVGEAIADYLKNGRADSESRSVFLRINAPIRGFKTEKAVCNVVRY
FT                   ALERAGIDSLRKGTHQFRHALATQMLRQGSSLAEISEVLRHKSPDSTRIYAKVDLDSLR
FT                   TLAPPWPSPRS"
FT   gene            complement(43769..44293)
FT                   /locus_tag="PHG047"
FT   CDS_pept        complement(43769..44293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG047"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Sinorhizobium meliloti putative
FT                   integrase/recombinase (NP_436129)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG047"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85800"
FT                   /db_xref="GOA:Q7WXS1"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXS1"
FT                   /protein_id="AAP85800.1"
FT                   /translation="MAGGTAMLKQTVQSYLEVRRACGFELKSQGNLLRSFAAYSDARGK
FT                   SHVCADTAIEWAGLARLAPRRARRLGEVIRFARYARAEDSRHEVPPPVFGSSQRIRPIP
FT                   YIFSTDEVRHLVQAASQSGRETLRRYTYSTLFALLACTGLRVSEAIGLRYEDITPEGLV
FT                   IRSSKFRNYAA"
FT   gene            complement(44269..45516)
FT                   /locus_tag="PHG048"
FT   CDS_pept        complement(44269..45516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG048"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Sinorhizobium meliloti putative
FT                   integrase/recombinase (NP_436128)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG048"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85801"
FT                   /db_xref="GOA:Q7WXS0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXS0"
FT                   /protein_id="AAP85801.1"
FT                   /translation="MLSQYFKSPSHVQLLLSRPGGPLLEGFSQYLEQLGYAKSSICTRI
FT                   AAASHFLCWANREGIPLPSFNELTLERFAEHLSRCQCQGFGHQRRIVSLRGARMFLTYQ
FT                   GGISTRAIGFTALAADLESVQFFAFCQWMRQQRGTSDATLYNHGIALRDLFRRGDDLGK
FT                   LNAMDLRQFILEQSMKKGWAAAKHCTTALRMLVRFLIAEGKCAAGLEAAIPVLAHWSLS
FT                   TLPRYLQLDEVERVIASCDTASPVGQRDRAILLLLARLGLRAGDIWHLRIGDIDWKDAS
FT                   ISVSGKNGRQTLLPLTQEVGQAIVDYLRQGRPRTDTDTVFVRACAPFQAFANHAAISII
FT                   VKKAMRRAGVVCSSRGAAHVLRHSVATSMLGQGASLQDIAAVLRHQSVATTQIYAKVDI
FT                   AALRQIAQPWPEELPC"
FT   gene            complement(45699..45989)
FT                   /locus_tag="PHG049"
FT   CDS_pept        complement(45699..45989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG049"
FT                   /product="putative transposase"
FT                   /note="similar to Azotobacter vinelandii gi:23102428"
FT                   /db_xref="EnsemblGenomes-Gn:PHG049"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85802"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXR9"
FT                   /protein_id="AAP85802.1"
FT                   /translation="MKREATSWAAAEFKDIDLGDQRLNKRAVLLAERLAEKPTASIPSA
FT                   CGGWAETAAAYRFLAQDELDWRDILAPHWQSSAERMRACEVVLCIQDTTEL"
FT   gene            46010..46327
FT                   /locus_tag="PHG050"
FT   CDS_pept        46010..46327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG050"
FT                   /product="putative hydrogenase-specific protease"
FT                   /note="similar to Ralstonia eutropha HoxW, N-terminus
FT                   (X92988)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG050"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85803"
FT                   /db_xref="GOA:Q7WXR8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXR8"
FT                   /protein_id="AAP85803.1"
FT                   /translation="MNDNPKEFTTPPAMSLTVNDFSRHTMGHDLCVMGCLEGSSACARA
FT                   EKVKFYQLNLEDADLISRKQRVLFVDASKDATLDSFRLYRAEPKMDFSFTSHGRCCTNR
FT                   I"
FT   gene            complement(46356..46889)
FT                   /locus_tag="PHG051"
FT   CDS_pept        complement(46356..46889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG051"
FT                   /product="putative transposase"
FT                   /note="similar to Acinetobacter haemolyticus putative
FT                   transposase (AAB67318)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG051"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85804"
FT                   /db_xref="GOA:Q7WXR7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXR7"
FT                   /protein_id="AAP85804.1"
FT                   /translation="MRKHGYSKRRTWRKVHLAMDAKSGQICAALMTHQDVGDADVLPDL
FT                   LDQLPPDTLVDIVRGDGAYDTKSCHAVIAATGAQPSIPPREGAMPWPETTPGAAWRNAA
FT                   IDAIATSSRREWKKDSGYHRRSLVENLMYRLKTLTGHSLWARKVGSQATEVAIRAGVLN
FT                   HMNELARPQSVRIA"
FT   gene            complement(47083..47445)
FT                   /locus_tag="PHG052"
FT   CDS_pept        complement(47083..47445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG052"
FT                   /product="hypothetical protein"
FT                   /note="predicted by FrameD"
FT                   /db_xref="EnsemblGenomes-Gn:PHG052"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85805"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXR6"
FT                   /protein_id="AAP85805.1"
FT                   /translation="MSGAMTDYYAALERLKNRKGARINNDTVAIEAGRKKGSIKKSRPQ
FT                   FTELIAAIDAANAVAGRPKLELTERLNRAKGDAKDLQAQLDESLARELALLHQVFRLRK
FT                   ELAALRGGSVLPLQLR"
FT   gene            complement(47442..49322)
FT                   /locus_tag="PHG053"
FT   CDS_pept        complement(47442..49322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG053"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Xanthomonas axonopodis pv. citri str. 306
FT                   gi:21244652"
FT                   /db_xref="EnsemblGenomes-Gn:PHG053"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85806"
FT                   /db_xref="GOA:Q7WXR5"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXR5"
FT                   /protein_id="AAP85806.1"
FT                   /translation="MNNTLIAPIAERPDWYRVEDDTVATRDKAANAVSLFSDAAWDIRA
FT                   YTIGPRTHIYFRGHLPDGASRALSEATTRQWKQVIYFLMHEATDTVPASSTLNSGSACL
FT                   KGFAFFAAERELTLYEGLSSVAIVLDYVAQPGMERKAQRLHSVLVKLHRLGVGTTGLRV
FT                   PLAQLHKPLLERFAQRAGNSQHPVVPTRIYQHFLLACEHDLGVAEGIVDVLSDYLARLY
FT                   AGESPSVPSELVRVAAHFGYKAVPYVASSLVASIRALCQLVILSFTGMRATEAESLPYD
FT                   CLSETRLDGVTHYTIEGITTKLSGGRPRRARWVTSPLAARAVGLAQRLSGEAHRAHGAQ
FT                   GYAESTDGSHLLFCRMGLHMGYVANRAASTVHNDIEAFRERVFPTITVEDIAELKRVDM
FT                   HRAWEDEPKYAVGRQWPFTRHQLRRTLALYAHRSGLVTLPTLKRQLQHITQEMSMYYAR
FT                   GSAFAKGFIDTDRTHFANEWAGAQGLSEYLAYAEQVLFSDVRLFGGHAAWTQSRAVQAS
FT                   PVSVYSREQTMRMFVKGELAYRETVLGGCASVEQCKSTPLDWMRLDCLESDCRNLVVVP
FT                   SKLRRVINAQQVTVAKLRAVDETSVEYRIEAQALQRLLDAQEKLIKSEAA"
FT   gene            complement(49319..51199)
FT                   /locus_tag="PHG054"
FT   CDS_pept        complement(49319..51199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG054"
FT                   /product="hypothetical protein"
FT                   /note="predicted by FrameD"
FT                   /db_xref="EnsemblGenomes-Gn:PHG054"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85807"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXR4"
FT                   /protein_id="AAP85807.1"
FT                   /translation="MSRQYEEVRMPLAEGTTLLHPERALLRWEGMSGRSDIGQICYLKR
FT                   DASSLRCTRRTFDPTSFSSERARVVRLLVTQLSGRMTLGAMRPRTVDGALRVVLEFVNW
FT                   ADRQGLHQVLCDEKTTAEAVHRYFRERREQVSLGNLKRNSVDISQRRLLSMLRELFRND
FT                   DFCADARVLGRQRDASVPTAVPDAEAQATLLAWADALFSGISTLVLDFKPYPVHVTTAR
FT                   GESLCLVPRRHHRRGGDGSHGLAGWNLETGEPRTREELTMRMAEAEAKNPSKRSGDIAR
FT                   SAAKHLAAANEDAQSEIRRSHASMAVFCFAALFLAETGVNLAQLLAMKWSLELAASLQD
FT                   ASVVRQKFREVKYRAGAKEITFTVSLGFMPKLKAYLALREYLVQDAGCDALFIVVGHSP
FT                   QRRRPMPLPTQFLTLLYDRLDTLGIVLPRISARQWRAAKQDWAVSNHGPVIAARLMGHS
FT                   VETALRSYSNGTDAAHKAEMGVFLASVEKAVLKTGDDPAGSIRSAVGVCIEFRKPVPIA
FT                   ASATVKPDCRSTEGCLFCDQYRVHADAADIHKLLGCRHCVRLVSGRADSIEQYDSSFGA
FT                   VLRRIDFLLDELRKRDAALVDQIEQDVDVDGNLDAFWSAKLDQLYELGVA"
FT   gene            complement(51196..51312)
FT                   /locus_tag="PHG055"
FT   CDS_pept        complement(51196..51312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG055"
FT                   /product="hypothetical protein"
FT                   /note="predicted by FrameD"
FT                   /db_xref="EnsemblGenomes-Gn:PHG055"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85808"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXR3"
FT                   /protein_id="AAP85808.1"
FT                   /translation="MRYLGYRENCKLFDAVQDGWGVHLSTLVARTLDTAVAA"
FT   gene            51476..52738
FT                   /locus_tag="PHG056"
FT   CDS_pept        51476..52738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG056"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Mesorhizobium loti putative
FT                   integrase/recombinase (NP_106607)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG056"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85809"
FT                   /db_xref="GOA:Q7WXR2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXR2"
FT                   /protein_id="AAP85809.1"
FT                   /translation="MEKSTRQVSSHLPLQQFVAGAVSELERLGYSRKSLWRYRVAWRHL
FT                   IEFCHEMSLGDKYSLELAKRFCSTYQVRADECLNSGQGWRRNIVFALKVLDGFAHEGHI
FT                   VRTVTDIKTIQVPEPMSTALRDYELYCRDRRHLRTTTLRARMRVIALFADFLGSRNITF
FT                   FDQVQPADLCAFVTAQHRLSAKSVSRIVSDVRCFLRFLLMRGILQQDLSHVLPVVHVPR
FT                   DATIPSVWDPEVLTKLLEAVDRTSPKGKRDYAIFLLACRLGLRVGDIRALSLDDLKWET
FT                   ATIEVRQSKTLTPLCLPLTEEVGEALIDYLRSGRPQSDHREVFLTLNAPFLPFREADSL
FT                   YWIVRHWKAIAGIHFRTPQRHGLHSLRHTLATRLLHEQTPFQVISDILGHATTASTLIY
FT                   AKTDVETLRTAALNTEKMRHV"
FT   gene            52731..53714
FT                   /locus_tag="PHG057"
FT   CDS_pept        52731..53714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG057"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Mesorhizobium loti putative
FT                   integrase/recombinase (NP_085858)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG057"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85810"
FT                   /db_xref="GOA:Q7WXR1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXR1"
FT                   /protein_id="AAP85810.1"
FT                   /translation="MSSSKFKGHFQSAVGPLMEQFVQEKQACGYRYNAQARLLACFDRF
FT                   LSDEALSACELPRSISRKWTAKRPHESKSTHDQRIGAVRQFALFMCRLGYAADVPDRSL
FT                   TARRTSSFSPRILTHAEIQRLFRAADQLTPTALSPMRHLVMPEVLRLLYGCGLRVGEVL
FT                   HLRVADVDLERGILTVRDGKFRKDRLVPPALPLVQRLRVYAQVMGDRPSDAYFFPSPSD
FT                   GPLSHSSIYWLYRELLLRSGIPHAGRGKGPRVHDLRHAYAVHALLRWCQDGADLDAKLP
FT                   VLATYMGHQSLAGTQRYLHLIAELFPEITARTGAAFGDVIPRRNGS"
FT   gene            53711..54721
FT                   /locus_tag="PHG058"
FT   CDS_pept        53711..54721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG058"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Mesorhizobium loti putative
FT                   integrase/recombinase (NP_106768)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG058"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85811"
FT                   /db_xref="GOA:Q7WXR0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXR0"
FT                   /protein_id="AAP85811.1"
FT                   /translation="MKPTDFSMLVTSFLTHHLAAQRNLSPNTIKAYRDVFTLLLRYCRD
FT                   VRGIALERLSLAQIDVGLVEAFLDHLANDRHVSVSTQNHRLAALHAFFRYVQSEVPERL
FT                   LQCQQVLAIPLRRQPRASVGYLPKEYLAQLLAQPDLRTSEGCRDAVMLSVLYDTGARVQ
FT                   ELIDLNAGDVRLDPPAQVRLMGKGRKPRAVPLMDSTVELLLQYRRDNHLDRPEYADKPL
FT                   FQNRQGTRLSRSGVRYLLQKYVIPVRRSHPDFTQRVSPHSLRHTKGMHLLQSGVPLEII
FT                   RDFLGHVDVKTTEIYARANLEMKRKALEKATDGASLPKIPSWQQNKALLEWLHSL"
FT   gene            complement(54781..56217)
FT                   /locus_tag="PHG059"
FT   CDS_pept        complement(54781..56217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG059"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Xanthomonas axonopodis pv. citri str. 306
FT                   gi:21244651"
FT                   /db_xref="EnsemblGenomes-Gn:PHG059"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85812"
FT                   /db_xref="GOA:Q7WXQ9"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXQ9"
FT                   /protein_id="AAP85812.1"
FT                   /translation="MRIWAMTARRTTIRHLPLTEVVDRNTSGATPVSITTPEGGTIYHT
FT                   VPLADPDTGKRRDDRPQWITGTFPLFPVVRLADGAPWAEANLWLIDMIESKPSPNMLTF
FT                   ASIADDLVAFRRYLDNEGVDWLAFPANKRQRPTYRYSASIRLAVQAGELSPGVARRRMG
FT                   AVVRFYRWLMTEAGFRPANAPWAESGRFIEFRDHKGFSRAIEVKTTDLSISGRRADDPW
FT                   DDHIQDGGRLRPLPSAEQSVLLESLATLGNTEMTLVHLFALLTGARIQTVLTVRARHVM
FT                   RKPGEFHGDDIRLACGPGTGIDTKGGVKGVLHLPRSFYERLYTYVHSDRARKRRQLADG
FT                   GDHPVQPLFLSYRGAPLYEDRASRRPVSTGPQVRRHVKTGQAVRQFIRDELLPMMRVQL
FT                   GNPRYEFSFHDLRATYGLNMVDTMTANETKYTRALDQLRQLMWHVQPSTTERYYRPKVF
FT                   MCSIGSSPAIAKVSARRNST"
FT   gene            complement(56242..56697)
FT                   /locus_tag="PHG060"
FT   CDS_pept        complement(56242..56697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG060"
FT                   /product="putative transposase"
FT                   /note="similar to Vibrio cholerae gi:11139679"
FT                   /db_xref="EnsemblGenomes-Gn:PHG060"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85813"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXQ8"
FT                   /protein_id="AAP85813.1"
FT                   /translation="MRRDTQKQAEPKGTYRVKNWAQYNAGLIARGDVTMWIDQSVLASP
FT                   GVGVSKRGRPCVYSDAVIQMLLGLKQVFRLPLRALQGFAMSLRKLAFADLPVPNYSTLS
FT                   RRAQDLNVVLPVQRASQSLHLVVDSTGLKVFGVCASQERFLDTRTLC"
FT   gene            complement(57725..58045)
FT                   /locus_tag="PHG061"
FT   CDS_pept        complement(57725..58045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG061"
FT                   /product="putative transposase"
FT                   /note="similar to Ralstonia solanacearum IS1021
FT                   transposase, C-terminus (NP_521767)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG061"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85814"
FT                   /db_xref="GOA:Q7WXQ7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXQ7"
FT                   /protein_id="AAP85814.1"
FT                   /translation="MPPLSRRHPRPRTEKSRDPEMHQAKKGNAWHFGMTAHLGVDAASG
FT                   LVHSVVGTAANDSDVSQAHALLHGHEDHAFGDAGYTGVDKRDEMQGKSVKPAKYEVEST
FT                   FL"
FT   gene            complement(57963..58475)
FT                   /locus_tag="PHG062"
FT   CDS_pept        complement(57963..58475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG062"
FT                   /product="putative transposase"
FT                   /note="similar to Ralstonia solanacearum IS1021
FT                   transposase, N-terminus (NP_521767)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG062"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85815"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXQ6"
FT                   /protein_id="AAP85815.1"
FT                   /translation="MKRQISFVEAEGHGKKRVTRRQRFLTEMVSVVPWSGLIAAVEPYY
FT                   PKGKRERPPIGLERMLRIYFLQQWYGLSDEALEDALYDSMAMRAFAGIDLAVEAVPDAT
FT                   TLLKFRRLLVEHELTRKLFEEIGIMLCERGLMMKEGTIVDATIIEAPPSTKNGEEPRPG
FT                   DAPGQEG"
FT   gene            complement(58601..59635)
FT                   /gene="hoxN2"
FT                   /locus_tag="PHG063"
FT   CDS_pept        complement(58601..59635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxN2"
FT                   /locus_tag="PHG063"
FT                   /product="putative nickel permease"
FT                   /note="NiCoT family; TC 2.A.52"
FT                   /db_xref="EnsemblGenomes-Gn:PHG063"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85816"
FT                   /db_xref="GOA:Q7WXQ5"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXQ5"
FT                   /protein_id="AAP85816.1"
FT                   /translation="MRPILSCLLDDSQVDARSRTRDIYAVLLAVNVGAWGLAIFAFHRN
FT                   PMLLGTALLAYTLGLRHAVDTDHLAAIDNVARKLMQEHKTPLAVGFMFSLGHSTVVLFG
FT                   SIAIVMAASALHQRTGPFREIGGMIGIGVSAGFLIAIALMNLVVLRSLCRTWWQLHTGK
FT                   AGAAEEPDRLLNGRGLLARLYRPMFRMVTRSWHMYPLGLLFGLGFDTATEIGLLGIAAT
FT                   EASKDLPLASILLFPLLFAAGMALVDTTDGILMLGAYGWALDQPVRKLYYNMSVTFLSV
FT                   IIAIVVGVVQVTGVAARLESGSAFWLQLGKANDEFGLAGLVIMGTFILVWSMSALAHKL
FT                   QPAD"
FT   gene            59962..61017
FT                   /locus_tag="PHG064"
FT   CDS_pept        59962..61017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG064"
FT                   /product="putative [NiFe] hydrogenase small subunit"
FT                   /note="similar to Streptomyces avermitilis hydrogenase
FT                   (BAB69211)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG064"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85817"
FT                   /db_xref="GOA:Q7WXQ4"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="PDB:5AA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXQ4"
FT                   /protein_id="AAP85817.1"
FT                   /translation="MAEQAVPYGRKTQHTPALKEVHILWITAGLGCDGDSVSITAASQP
FT                   SVEDVVLGAIPGLPKVHLHNPVLAYENGDEFMAPFHKAARGEIDNFVLVLEGSIPNERI
FT                   NGEGYWAAMGTDPQTHQPITIPEWLDRLAPKALAVVGAGTCATYGGIHAMEGNPTGCMG
FT                   LADYLGWQWKSRAGLPIVNVPGCPVQPDNFMETLLYLLYQLAGLAPMIPLDEALRPKWL
FT                   FTRTVHDGCDRAGSYEQAIFATEYGNPNCIVKLGCWGPVVQCNVPKRGWIAGVGGCPNV
FT                   GGICIGCTMPGFPDKFMPFMDAPPGAVLSSNLIKSYGPLIRSLRKLTKDTLNDEPKWRH
FT                   NQPVLTTGYRG"
FT   gene            61055..62866
FT                   /locus_tag="PHG065"
FT   CDS_pept        61055..62866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG065"
FT                   /product="putative [NiFe] hydrogenase large subunit"
FT                   /note="similar to Streptomyces avermitilis hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG065"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85818"
FT                   /db_xref="GOA:Q7WXQ3"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="PDB:5AA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXQ3"
FT                   /protein_id="AAP85818.1"
FT                   /translation="MATIAAPGARPRAQAAPGKLVEMNWDPITRIVGSLGIYTKIDFEN
FT                   RRVAECYSTSSIFRGYSIFMKGKDPRDSHFITSRICGICGDNHATCSVYAQNMAYGVKP
FT                   PPIADWIINLGEAAEYMFDHNIFQDNLVGVDFCEQMVRETNPGVWEKAKTAEAPHAAEH
FT                   GYRTIADIMTALNPFTGEFYRETLLVSRYTREMFCLMEGRHVHPSTLYPGGVGTVPTIQ
FT                   LFTDYITRLMKYVEFMKKVVPLHDDLFDFFYEALPGYEEVGRRRILLGCWGSFQDPNVC
FT                   DYNYRTMTKWGRGMFVTPGVVVDGELLTTDLVDINLNIRILLGSSFYQDWDHEETSVKN
FT                   DPLGNAVDRKHPWNQTTLPRPQKRNFGGNYTWVMSPRWLDKRTGDHLALDTGGGPIARL
FT                   WATALAGLVDIGYIKSTGHSVKIYLPRTALKPEAEFEWKIPMWSNAIERDRARTYFQAY
FT                   SAAAALYFAEQALAELHAGRTRTFTDFKVPDEAIGCGFHEAVRGVLSHHLVIRDGKIAN
FT                   YHPYPPTPWNASPRDIYGTPGPYEDAVQNTPIFEENGPEKFKGIDIMRAVRSFDPCLPC
FT                   GVHMYVGNGKTIEQSHSPTFGVMAGAH"
FT   gene            62866..63444
FT                   /locus_tag="PHG066"
FT   CDS_pept        62866..63444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG066"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Chloroflexus aurantiacus gi:22974151"
FT                   /db_xref="EnsemblGenomes-Gn:PHG066"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85819"
FT                   /db_xref="GOA:Q7WXQ2"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXQ2"
FT                   /protein_id="AAP85819.1"
FT                   /translation="MSGARTVQAQQQRIEAMIAALESVDDNQASALARELLRVVLDLHA
FT                   GGLARVMEIVSMAGIQDNPVVEALVRDPAVCALLNLHGLHPHDLPTRVARAVEHMRAAL
FT                   GTQGVTIELRDAAEEAVRVQVSGRLQGKHASPESLRQEIEQAIFEQAPEVVRVEIAGLA
FT                   DIDVHELRFVPAREMRGPDRQGRVGGGQP"
FT   gene            63441..64103
FT                   /locus_tag="PHG067"
FT   CDS_pept        63441..64103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG067"
FT                   /product="hypothetical protein"
FT                   /note="predicted by FrameD"
FT                   /db_xref="EnsemblGenomes-Gn:PHG067"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85820"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXQ1"
FT                   /protein_id="AAP85820.1"
FT                   /translation="MSAGPFPEARTGVQGCGGWVARLRQFTRKADYAQCELCGASIVAD
FT                   HAHLFDTTRRQLHCCCRACALLFGSQQGSRYRPVPRAGRYLDGFRMSDAQWDALAIPID
FT                   VAFFFVDSGAAHVVALYPGPAGGTRSQLGLAAWDDLVADNPDLTRMRPDVEALLVYRAQ
FT                   GARDYFLAPIDQCYALTGLIRARWRGLSGGKPAWEAIRGFVAALKATGRVPEGLLHA"
FT   gene            64096..64743
FT                   /locus_tag="PHG068"
FT   CDS_pept        64096..64743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG068"
FT                   /product="hypothetical protein"
FT                   /note="predicted by FrameD"
FT                   /db_xref="EnsemblGenomes-Gn:PHG068"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85821"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXQ0"
FT                   /protein_id="AAP85821.1"
FT                   /translation="MPDLTFSISAAEVAPFAAVPLLLFKLQIANAPAGEEIASITLQCQ
FT                   IQIEATRRRYAPAEHDGLQDLFGVPQRWTQTLRTMLWTHATVIVPAFSGTCVIDLLVPC
FT                   SFDFNIAATKYCHALQDGEIPLMLQFSGTVFYRNADDALQAAPVPWHKEAAFRLPVAVW
FT                   HDMMARYYPNGAWLCLQREVFDRLGRYKAQQGLATWERALDALLDGAEEKAS"
FT   gene            64740..66170
FT                   /locus_tag="PHG069"
FT   CDS_pept        64740..66170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG069"
FT                   /product="hypothetical protein"
FT                   /note="predicted by FrameD"
FT                   /db_xref="EnsemblGenomes-Gn:PHG069"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85822"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXP9"
FT                   /protein_id="AAP85822.1"
FT                   /translation="MNQVDSVIQAVLYEGYMLYPYRASAVKNRQRWTFGGVYPRAYSVA
FT                   SGSDPWMTQTECLLCGDADARVTVAPGFLQVADRTVLAASEDLSEGGTGNTTPWRVVPV
FT                   LDVDDRRFHPWQEAVERRLALPSMRLGELLDASRIEPFAFAGSAEIELLADREGVARGA
FT                   LRRTHAALVGHVGVGAERVDDRVCRLTARIVNLTPLADAGALTRDAASVYALVSCHMVL
FT                   SLEQGWFLSSMDPPRALAEASAACRNIGTWPVLVGQDGEEGEGGHRTMLASPIILYDFP
FT                   QIAPESAGDLFDATEIDEILTLRILAMTDDEKREMAATDERARALLARTEQLGTQQLQK
FT                   LHGAMRHIRGGAELTEVPDLSGDPGALNESGTPSSPWAGLDAGPRLACLRVGGMEIRVG
FT                   DHVRLRPRSRADIFDMALNGQLATIESIERDLEDRVHVAVTVDCDPGKDFGLARMPGHR
FT                   FFFRPDEIEPLGGAEAQA"
FT   gene            66167..66718
FT                   /locus_tag="PHG070"
FT   CDS_pept        66167..66718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG070"
FT                   /product="putative [NiFe] hydrogenase-specific C-terminal
FT                   protease"
FT                   /note="similar to Aquifex aeolicus hydrogenase maturation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG070"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85823"
FT                   /db_xref="GOA:Q7WXP8"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXP8"
FT                   /protein_id="AAP85823.1"
FT                   /translation="MSGILVAGIGNVFLGDDGFGVEVVQRLGARQAAHALPPFPEGVVV
FT                   ADFGIRGIDLCYALLDGVDAAILVDATQRGGAPGSLYVIELPMDAQDGDGAGDPYASPV
FT                   LMSPHEMNPALVLRALRMMGGTCADVVVIGCEPADFGLGEGEEGRLGLSEPVAAAVDRA
FT                   VAMVEAMVGRKAEQLYGRPA"
FT   gene            66753..66854
FT                   /locus_tag="PHG071"
FT   CDS_pept        66753..66854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG071"
FT                   /product="hypothetical protein"
FT                   /note="predicted by FrameD"
FT                   /db_xref="EnsemblGenomes-Gn:PHG071"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85824"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXP7"
FT                   /protein_id="AAP85824.1"
FT                   /translation="MKGFLKYLVLPALVVALLANIKDIRRYIRIRSM"
FT   gene            66953..69343
FT                   /gene="hypF3"
FT                   /locus_tag="PHG072"
FT   CDS_pept        66953..69343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypF3"
FT                   /locus_tag="PHG072"
FT                   /product="HypF3"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /note="similar to Thiocapsa roseopersicina (AAK56850) and
FT                   Nostoc sp. PCC 7120 HypF (NP_484737)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG072"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85825"
FT                   /db_xref="GOA:Q7WXP6"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXP6"
FT                   /protein_id="AAP85825.1"
FT                   /translation="MRGMVQGVGFRPTVWRLAHDCGLSGSVRNDSDGVQIRAWGDAVAL
FT                   DRFIARLRDECPPLARIDAIERRVLAQDAEGADLGGFRIVASVGGPVRTGVVPDAVVCS
FT                   ACIADIGDPLNRRYRYPFANCTHCGPRLSIVRAIPYDRANTAMAAFPMCPACLAEYEDP
FT                   ADRRFHAQPLACAACGPHVWLEHTGGPLAAGPDDAIRAAWALLRDGGIVAIKGIGGFQL
FT                   ACDACNPVAVARLRQRKRRERKPFALMARDLAVIRQYSEPTAAECGLLQSPAAPIVIVQ
FT                   TRSDRQGAPLAPDVAPGIAALGFMLPGTPLHWLLMAMADRPIVLTSGNASDEPQCTENA
FT                   DARMRLGAIADAFLMHDRDVVRRVDDSVARVVLDVPRVMRRSRGYAPAPLPLPPGFAAA
FT                   APVLAMGGELKNTFCLMRAGEAILSHHMGDLEDALTHADYRRALTQYMALFEHGPHLVA
FT                   VDMHPEYLSGKIGRDLARQGQLPVAQVQHHHAHIAACMAENRVALAAGPVLGVALDGIG
FT                   YGVDGSLWGGEFLLADYRDFTRLACFKPVGMPGGERAIHQPWRNTYAHLAAAVGWDTLI
FT                   ARHASLALVRFLATRPREVLDAMLTRSINSPLASSAGRLFDAVAAAAGVCPERACYEGQ
FT                   AAMEFEALADRRTLSEEDDGRAYPFAIVPGTPACLEPGPMWVALLADLARATPAPLISA
FT                   RFHKGLAIAIASMVAYLADCPGAGCRAVPVALSGGVFQNRILLEQVATRLSAQGRRVLT
FT                   HSQVPANDGGLSFGQAAIAAARSLGGADVAGQANAGYRSTTCA"
FT   gene            69334..69621
FT                   /gene="hypC2"
FT                   /locus_tag="PHG073"
FT   CDS_pept        69334..69621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypC2"
FT                   /locus_tag="PHG073"
FT                   /product="HypC2"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /note="similar to Nostoc sp. PCC 7120 HypC (NP_484738)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG073"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85826"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXP5"
FT                   /protein_id="AAP85826.1"
FT                   /translation="MCLGIPGQILEVRDAANALAMVEVGGVRRLINIAFIVDDDHKAEA
FT                   CVGEWVLVHVGFAMSRLDEAEAARTLALLHELGIAQAEFDEMRAGSPAPP"
FT   gene            69693..70382
FT                   /gene="gmhA"
FT                   /locus_tag="PHG074"
FT   CDS_pept        69693..70382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="PHG074"
FT                   /product="putative sedoheptulose 7-phosphate isomerase"
FT                   /note="similar to Clostridium acetobutylicum phosphoheptose
FT                   isomerase (NP_349654)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG074"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85827"
FT                   /db_xref="GOA:Q7WXP4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXP4"
FT                   /protein_id="AAP85827.1"
FT                   /translation="MPGETPLQGLYPFLHGERQDGARLDAALLASVQQKASDSIDAKRR
FT                   FFEQNGPVVVAVAQAIALTYRNGGRLFAMGNGGSSCDAAHIAVEFLHPVTAGRPALAAV
FT                   NLVADTAMMTAVGNDVGFAHVFVRQLVAQARRGDALIGVSTSGNSENLLAAFAKGKEMG
FT                   LATIGLSGHDGGRMAASADLDHCLVVDSDSIHRVQETHVAIYHILWDLVHTLLAEDRGG
FT                   LAAGGAR"
FT   gene            70379..71590
FT                   /gene="hypD2"
FT                   /locus_tag="PHG075"
FT   CDS_pept        70379..71590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypD2"
FT                   /locus_tag="PHG075"
FT                   /product="HypD2"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /note="similar to Nostoc punctiforme HypD (AAG49378)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG075"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85828"
FT                   /db_xref="GOA:Q7WXP3"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXP3"
FT                   /protein_id="AAP85828.1"
FT                   /translation="MKYVDEFRDPAKAQALAREIRDLVAGMGRARRRPLQIMEVCGGHT
FT                   HTIFRYGIQQLLPDEVEFVHGPGCPVCVLPMGRVDDCVALAERPEVIFTTFGDAMRVPG
FT                   SRKSLLKAKADGADVRMVYSPIDALALARNHPDREVIFFGLGFETTMPSTAMTVLRARA
FT                   EGVRNFSLFCNHITIIPTIKAILDSPDLQIDGFLGPGHVSMVIGTQPYEFIARHYRKPI
FT                   TVAGFEPLDVLQSMWMVLRQIAQGRCEVENQYGRIVPAAGNAQALAAIQEVFELREFFE
FT                   WRGLGSIDFSGVRMREAFSAFDAERKFTVPDVKIADPKACQCGEVLKGVIKPHQCKVFG
FT                   TACTPESPLGSLMVSSEGACAAYYHYCRIDTSRLGRHGARAAGQTATRDAVANERAAAG
FT                   AGHE"
FT   gene            71583..72650
FT                   /gene="hypE2"
FT                   /locus_tag="PHG076"
FT   CDS_pept        71583..72650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypE2"
FT                   /locus_tag="PHG076"
FT                   /product="HypE2"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /note="similar to Nostoc punctiforme HypE (AAG49379)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG076"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85829"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXP2"
FT                   /protein_id="AAP85829.1"
FT                   /translation="MNDRVPVPPARAARVRDTTINLTHGSGGRAMRDLIEDVFVSTFDN
FT                   PALAALEDQAVFPLVSLAAHGDRLAFTTDSYVVDPLFFPGGDIGTLAAAGTVNDLAVCG
FT                   ATPLFLSCGVVLEEGLPVDTLRRVAASMQRVARAAGVAIVTGDTKVVERGSADKLFINT
FT                   AGIGVVRAGLSISARHARAGDVVLVNGYLGDHGAAILVARQQLALEADLQSDCRPLNGL
FT                   VAAMLDACPDIHCLRDATRGGVATVLNEFAQASGVAIRIREVDVPLREAVKGACEILGL
FT                   DPLYLANEGILVAIVPPEDAARVLAAMRAHPDGRQAAAIGEVEPGPAGLVVLHTGFGGQ
FT                   RVVDMLVGEQLPRIC"
FT   gene            72687..73016
FT                   /gene="hypA3"
FT                   /locus_tag="PHG077"
FT   CDS_pept        72687..73016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypA3"
FT                   /locus_tag="PHG077"
FT                   /product="HypA3"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /note="similar to Nostoc sp. PCC 7120 hydrogenase
FT                   expression/formation protein (NP_484742)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG077"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85830"
FT                   /db_xref="GOA:Q7WXP1"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXP1"
FT                   /protein_id="AAP85830.1"
FT                   /translation="MHELSIANSVVEICAEQARGARVLWVQLEIGRLCAVMPDAIRFCF
FT                   DVCAKDTAVEGAELEIVETPGVARCLACGAELEIAVPFGQCACGSENLELISGQQLKIR
FT                   RMEVA"
FT   gene            73016..74032
FT                   /gene="hypB3"
FT                   /locus_tag="PHG078"
FT   CDS_pept        73016..74032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypB3"
FT                   /locus_tag="PHG078"
FT                   /product="HypB3"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /note="similar to Nostoc sp. PCC 7120 'hydrogenase
FT                   expression/formation protein' (NP_484743)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG078"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85831"
FT                   /db_xref="GOA:Q7WXP0"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXP0"
FT                   /protein_id="AAP85831.1"
FT                   /translation="MCTTCGCGDTTGAVVSGPAAEGEPAPTAGAGQDVVHAHPYPDAMS
FT                   PGPAQEAGGMVLRKHPADDHAGHAGALLHAPMHRRAMHYHDHPLEHAHAHSHEHAHEHA
FT                   HEHAHIHGTSVVIEQDILAKNQWIAQRNRGWLAGRSIVALNLVSSPGAGKTTLLERTIR
FT                   DLGPTLELTVIEGDQATLNDAQRIRAAGCRAIQVNTGTGCHLDADMISRALTALDPPPH
FT                   SVVMIENVGNLICPALFDLGEQAKVVILSVTEGEDKPLKYPHMFRASSLMLMTKTDLLP
FT                   YVSFDVARCLACARQVNPDIAILQVSALSGAGMDDWYLWLRTACAGRIAPPEDSFPA"
FT   gene            74559..75377
FT                   /locus_tag="PHG079"
FT   CDS_pept        74559..75377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG079"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22978641"
FT                   /db_xref="EnsemblGenomes-Gn:PHG079"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85832"
FT                   /db_xref="GOA:Q7WXN9"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXN9"
FT                   /protein_id="AAP85832.1"
FT                   /translation="MLPGIGPLATIAMLLPVTYTLPPVAALIMLAGIYYGAQYGGSTTA
FT                   ILVNLPGESSSVVTTIDGYQMARRGRAGVALATAGIGSFFAGCVSTLILAAFATPLSEL
FT                   AFKFGPAEYFSLMCLGLIGAVVLASGSLPEAVAMIVLGLLLGLVGTDVNSGAARFSFDV
FT                   PELTDGIDFVALAMGMFGFAEIIANLEQKEHRETFTDHVTNLWPSKADFRRMAPAAARY
FT                   RARLHSGHPARRRCGAGFVRSLLAGKEDLEVLARVRQGRHRRRGRSGVGQ"
FT   gene            75061..75957
FT                   /locus_tag="PHG080"
FT   CDS_pept        75061..75957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG080"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22978641"
FT                   /db_xref="EnsemblGenomes-Gn:PHG080"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85833"
FT                   /db_xref="GOA:Q7WXN8"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXN8"
FT                   /protein_id="AAP85833.1"
FT                   /translation="MASTSSRWPWACSALPRSSPTSNRKNTARPLPITSPIYGPPRRTS
FT                   GAWHPPLRGTALGSILGILPGGGAALASFAAYSLEKKTSKYSQEFGKGAIEGVAGPESA
FT                   NNAAAQTSFIPLLTLGIPPNAVMALMVGAMAIHNIQPGPQVMTSNPALFWGLIASMWIG
FT                   NLMLIILNLPLIGIWVKLLQVPYRYLYPAILVFCCIGVFSVNNQTFDVFTAAGFGVIGY
FT                   LFIKLQCEPAPLLLGFVLGPMMEENFRRTLLLSRGTFTVFVTGPLSLSLLIAAALLVGI
FT                   VALPSIKAKREEAFQEE"
FT   gene            complement(76062..76625)
FT                   /locus_tag="PHG081"
FT   CDS_pept        complement(76062..76625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG081"
FT                   /product="putative sensor of two-component regulatory
FT                   systems"
FT                   /note="similar to C-terminus of histidine protein kinases
FT                   similar to Ralstonia metallidurans gi:22975230"
FT                   /db_xref="EnsemblGenomes-Gn:PHG081"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85834"
FT                   /db_xref="GOA:Q7WXN7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXN7"
FT                   /protein_id="AAP85834.1"
FT                   /translation="MDTLRSCLDEVGRLTLLVEDLLMLARLDAGQEHPSGQTVALNAVV
FT                   QETLRRVEPSARERQITLVVNATSPVDGKVARGPVSLVLANLLDNALKFSPPGGKIIVD
FT                   CATDQLDAVLSVADEGPGILESELPYLFDRFYRGAGARAGTAEGVGLGLALSQEVIRAY
FT                   GGHIEAGNVPGSGAVFSLRVPLAA"
FT   gene            complement(77083..77346)
FT                   /locus_tag="PHG082"
FT   CDS_pept        complement(77083..77346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG082"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Mesorhizobium loti putative
FT                   integrase/recombinase, C-terminus (NP_106529)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG082"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85835"
FT                   /db_xref="GOA:Q7WXN6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXN6"
FT                   /protein_id="AAP85835.1"
FT                   /translation="MPSLASKRVSPHSIRHSTATHLLRSGVDINTVRAWLGHVSIDTTN
FT                   VYAEIDLEMKANALARLTIASDREAIRRWAKDPALMAFLRSL"
FT   gene            complement(77403..77909)
FT                   /locus_tag="PHG083"
FT   CDS_pept        complement(77403..77909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG083"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Mesorhizobium loti putative
FT                   integrase/recombinase, central part (NP_106768)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG083"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85836"
FT                   /db_xref="GOA:Q7WXN5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXN5"
FT                   /protein_id="AAP85836.1"
FT                   /translation="MTDMSAEIVRDFLSDIEVRRGCSVATRNQRLAAIHALARFVGEHS
FT                   PEHIQWCTQLRCIPYKKTTRAVVPYLDKAEMDALLACPDRRTSQGRRDYALLLFLYNAG
FT                   VRADEAAHLTIGNVDAISSSVSVLGKIRNSASVRYGPTPCKSCATSLANDHRRNGYSSI
FT                   AVGNP"
FT   gene            complement(77686..78219)
FT                   /locus_tag="PHG084"
FT   CDS_pept        complement(77686..78219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG084"
FT                   /product="putative transposase"
FT                   /note="Pfam entry PF01527; similar to Ralstonia
FT                   metallidurans gi:22975527"
FT                   /db_xref="EnsemblGenomes-Gn:PHG084"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85837"
FT                   /db_xref="GOA:Q7WXN4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXN4"
FT                   /protein_id="AAP85837.1"
FT                   /translation="MSGKQTRAKYTQEYKLEAVRQVRAGQSIAVTAKVLGIPKGSLGAW
FT                   MRQSEKGELAAGTIGKPVTVTPEQMEPRSQHPAELPRHAVPTDPFRFRSSPQTGRPAGN
FT                   DRYVGRDRPGLPLRYRSPSRMQRRDAESASGCYPCFGSIRWRAQPGTYPMVHPVALHPV
FT                   QEDYKSGGALSRQG"
FT   gene            complement(78253..78474)
FT                   /locus_tag="PHG085"
FT   CDS_pept        complement(78253..78474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG085"
FT                   /product="putative transposase"
FT                   /note="similar to Burkholderia fungorum gi:22986320"
FT                   /db_xref="EnsemblGenomes-Gn:PHG085"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85838"
FT                   /db_xref="GOA:Q7WXN3"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXN3"
FT                   /protein_id="AAP85838.1"
FT                   /translation="MGGLCHATFAGPEAVLAYLSRYTHRVAISNQRLLALDERGVTFRW
FT                   KDYRAKGRTRYKTMTLDVGDLAPEEWSS"
FT   gene            complement(78351..79112)
FT                   /locus_tag="PHG086"
FT   CDS_pept        complement(78351..79112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG086"
FT                   /product="putative transposase"
FT                   /note="similar to Burkholderia fungorum gi:22986320"
FT                   /db_xref="EnsemblGenomes-Gn:PHG086"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85839"
FT                   /db_xref="GOA:Q7WXN2"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXN2"
FT                   /protein_id="AAP85839.1"
FT                   /translation="MEILDLGQQLSLPVFEPLRAGERLALRAGAMPAGNGLLSITCRNR
FT                   HCPKCQASAARRWLEARSDDLLPVEYYHVVFTLPAPISAIAWYNKAVIYGLLFDVAADT
FT                   LRTIAADPKHLGAQIGATLVLHTWGSALTHHPHVHGIVPGGGLSLDGERWVACRPGFFL
FT                   PVRVLSRLFRRRFLEALQAAHGRGQLRFFGDYATLADPAAFAQWIAPLREWVVYATRPS
FT                   PGPRRYWPTCRAIPTAWRSPTSACSPWTSVA"
FT   gene            78711..79364
FT                   /locus_tag="PHG087"
FT   CDS_pept        78711..79364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG087"
FT                   /product="putative transposase"
FT                   /note="Pfam entry PF04986; similar to Mesorhizobium loti
FT                   transposase, central part gi:13475379"
FT                   /db_xref="EnsemblGenomes-Gn:PHG087"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85840"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXN1"
FT                   /protein_id="AAP85840.1"
FT                   /translation="MRECRSPGVQHQGGANLRAEVLRVGGDGAQGVGGDIKQQAVDHRL
FT                   VVPRDGADGRGQREHDVVVLHGQQIVTARFEPATCRAGLALGAMPVAAGNGEQPITCRH
FT                   RACPKCQSLARAQWLEHRQAELLPEVEYFHVVFTVPDPIAALAYQNKNLYDILFRTSAE
FT                   TLRTIAADPKHLGAEIGGQTSSGPAHRFVAAIANQKNPLLREIRTLRSVGTGGG"
FT   gene            79712..81520
FT                   /gene="hoxF"
FT                   /locus_tag="PHG088"
FT   CDS_pept        79712..81520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxF"
FT                   /locus_tag="PHG088"
FT                   /product="NAD-reducing hydrogenase diaphorase moiety large
FT                   subunit"
FT                   /function="subunit of NAD-reducing [NiFe] hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG088"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85841"
FT                   /db_xref="GOA:P22317"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22317"
FT                   /protein_id="AAP85841.1"
FT                   /translation="MDSRITTILERYRSDRTRLIDILWDVQHEYGHIPDAVLPQLGAGL
FT                   KLSPLDIRETASFYHFFLDKPSGKYRIYLCNSVIAKINGYQAVREALERETGIRFGETD
FT                   PNGMFGLFDTPCIGLSDQEPAMLIDKVVFTRLRPGKITDIIAQLKQGRSPAEIANPAGL
FT                   PSQDIAYVDAMVESNVRTKGPVFFRGRTDLRSLLDQCLLLKPEQVIETIVDSRLRGRGG
FT                   AGFSTGLKWRLCRDAESEQKYVICNADEGEPGTFKDRVLLTRAPKKVFVGMVIAAYAIG
FT                   CRKGIVYLRGEYFYLKDYLERQLQELREDGLLGRAIGGRAGFDFDIRIQMGAGAYICGD
FT                   ESALIESCEGKRGTPRVKPPFPVQQGYLGKPTSVNNVETFAAVSRIMEEGADWFRAMGT
FT                   PDSAGTRLLSVAGDCSKPGIYEVEWGVTLNEVLAMVGARDARAVQISGPSGECVSVAKD
FT                   GERKLAYEDLSCNGAFTIFNCKRDLLEIVRDHMQFFVEESCGICVPCRAGNVDLHRKVE
FT                   WVIAGKACQKDLDDMVSWGALVRRTSRCGLGATSPKPILTTLEKFPEIYQNKLVRHEGP
FT                   LLPSFDLDTALGGYEKALKDLEEVTR"
FT   gene            81517..82221
FT                   /gene="hoxU"
FT                   /locus_tag="PHG089"
FT   CDS_pept        81517..82221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxU"
FT                   /locus_tag="PHG089"
FT                   /product="NAD-reducing hydrogenase diaphorase moiety small
FT                   subunit"
FT                   /function="subunit of NAD-reducing [NiFe] hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG089"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85842"
FT                   /db_xref="GOA:P22318"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR016214"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22318"
FT                   /protein_id="AAP85842.1"
FT                   /translation="MSIQITIDGKTLTTEEGRTLVDVAAENGVYIPTLCYLKDKPCLGT
FT                   CRVCSVKVNGNVAAACTVRVSKGLNVEVNDPELVDMRKALVEFLFAEGNHNCPSCEKSG
FT                   RCQLQAVGYEVDMMVSRFPYRFPVRVVDHASEKIWLERDRCIFCQRCVEFIRDKASGRK
FT                   IFSISHRGPESRIEIDAELANAMPPEQVKEAVAICPVGTILEKRVGYDDPIGRRKYEIQ
FT                   SVRARALEGEDK"
FT   gene            82218..82847
FT                   /gene="hoxY"
FT                   /locus_tag="PHG090"
FT   CDS_pept        82218..82847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxY"
FT                   /locus_tag="PHG090"
FT                   /product="NAD-reducing hydrogenase hydrogenase moiety small
FT                   subunit"
FT                   /function="subunit of NAD-reducing [NiFe] hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG090"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85843"
FT                   /db_xref="GOA:P22319"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22319"
FT                   /protein_id="AAP85843.1"
FT                   /translation="MRAPHKDEIASHELPATPMDPALAANREGKIKVATIGLCGCWGCT
FT                   LSFLDMDERLLPLLEKVTLLRSSLTDIKRIPERCAIGFVEGGVSSEENIETLEHFRENC
FT                   DILISVGACAVWGGVPAMRNVFELKDCLAEAYVNSATAVPGAKAVVPFHPDIPRITTKV
FT                   YPCHEVVKMDYFIPGCPPDGDAIFKVLDDLVNGRPFDLPSSINRYD"
FT   gene            82865..84331
FT                   /gene="hoxH"
FT                   /locus_tag="PHG091"
FT   CDS_pept        82865..84331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxH"
FT                   /locus_tag="PHG091"
FT                   /product="NAD-reducing hydrogenase hydrogenase moiety large
FT                   subunit"
FT                   /function="subunit of NAD-reducing [NiFe] hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG091"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85844"
FT                   /db_xref="GOA:P22320"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22320"
FT                   /protein_id="AAP85844.1"
FT                   /translation="MSRKLVIDPVTRIEGHGKVVVHLDDDNKVVDAKLHVVEFRGFEKF
FT                   VQGHPFWEAPMFLQRICGICFVSHHLCGAKALDDMVGVGLKSGIHVTPTAEKMRRLGHY
FT                   AQMLQSHTTAYFYLIVPEMLFGMDAPPAQRNVLGLIEANPDLVKRVVMLRKWGQEVIKA
FT                   VFGKKMHGINSVPGGVNNNLSIAERDRFLNGEEGLLSVDQVIDYAQDGLRLFYDFHQKH
FT                   RAQVDSFADVPALSMCLVGDDDNVDYYHGRLRIIDDDKHIVREFDYHDYLDHFSEAVEE
FT                   WSYMKFPYLKELGREQGSVRVGPLGRMNVTKSLPTPLAQEALERFHAYTKGRTNNMTLH
FT                   TNWARAIEILHAAEVVKELLHDPDLQKDQLVLTPPPNAWTGEGVGVVEAPRGTLLHHYR
FT                   ADERGNITFANLVVATTQNNQVMNRTVRSVAEDYLGGHGEITEGMMNAIEVGIRAYDPC
FT                   LSCATHALGQMPLVVSVFDAAGRLIDERAR"
FT   gene            84315..84812
FT                   /gene="hoxW"
FT                   /locus_tag="PHG092"
FT   CDS_pept        84315..84812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxW"
FT                   /locus_tag="PHG092"
FT                   /product="[NiFe] hydrogenase (HoxH-specific) C-terminal
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:PHG092"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85845"
FT                   /db_xref="GOA:Q79IP0"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:Q79IP0"
FT                   /protein_id="AAP85845.1"
FT                   /translation="MNAPAEFPYVTLADFDDPSTLIYGIGNVGRQDDGLGWAFIDRLEA
FT                   ESLCSGAEVQRHYQLHLEDADLISRKRKVLFIDATKDASVASFSLERAEPRMDFSFTSH
FT                   AISIPSIMATCQRCFQCLPEVYVLAIRGYEWELRMGLTPQARHNLDDAIAHFSMRAERQ
FT                   TS"
FT   gene            84835..85338
FT                   /gene="hoxI"
FT                   /locus_tag="PHG093"
FT   CDS_pept        84835..85338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxI"
FT                   /locus_tag="PHG093"
FT                   /product="HoxI"
FT                   /db_xref="EnsemblGenomes-Gn:PHG093"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85846"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q79IN9"
FT                   /protein_id="AAP85846.1"
FT                   /translation="MKEQEIDRIATMIYEAPLGEYIGRDGAAILAEHAAEARLLKGDEF
FT                   LYRRGDVTSSFYIVTDGRLALVREKTNERTAPIVHVLEKGDLVGELGFIDQTPHSLSVR
FT                   ALGDAAVLSFSAESIKPLITEHPELIFNFMRAVIKRVHHVVVTVGEHERELQEYISTGG
FT                   RGRG"
FT   gene            85449..85790
FT                   /gene="hypA2"
FT                   /locus_tag="PHG094"
FT   CDS_pept        85449..85790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypA2"
FT                   /locus_tag="PHG094"
FT                   /product="HypA2"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /db_xref="EnsemblGenomes-Gn:PHG094"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85847"
FT                   /db_xref="GOA:Q7WXM9"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXM9"
FT                   /protein_id="AAP85847.1"
FT                   /translation="MHEMSLAVGVLQIVEDVAQRDGFSRVTAVRLEIGRLSSIEPEALR
FT                   FCFEEVVRGSVADGARLEIVDTPGAGWCLHCSETVAIGALYDPCPQCGGYQVQPTGGTE
FT                   MRVMDLEVA"
FT   gene            85836..86798
FT                   /gene="hypB2"
FT                   /locus_tag="PHG095"
FT   CDS_pept        85836..86798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypB2"
FT                   /locus_tag="PHG095"
FT                   /product="HypB2"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /db_xref="EnsemblGenomes-Gn:PHG095"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85848"
FT                   /db_xref="GOA:Q7WXM8"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXM8"
FT                   /protein_id="AAP85848.1"
FT                   /translation="MCTNCGCAAGETRIEGQELEHVDEHAHADGTVHGHAPHHHGEHDH
FT                   DHGPAYRAVRGTDHLHYGHGPAGAHAPGMSQARMVKIEQDILGKNNAYAAQNRRWFDEH
FT                   GVFALNFVSSPGSGKTTLLVRTIEALKSTSRLAVIEGDQQTSFDAERIRATGVQALQIN
FT                   TGKGCHLDAHMVGHALEKLRPEDESVLLIENVGNLVCPSAFDLGEAHKVVILSVTEGED
FT                   KPLKYPDMFRAASLMLLNKCDLLPHLSFDVERAIEYAKRVNPDLHVIRTSSATGEGFDA
FT                   WLTWIADGLAGQAARRSQSMELLRSRIAGLEAQLAALKV"
FT   gene            86804..89227
FT                   /gene="hypF2"
FT                   /locus_tag="PHG096"
FT   CDS_pept        86804..89227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypF2"
FT                   /locus_tag="PHG096"
FT                   /product="HypF2"
FT                   /function="[NiFe] hydrogenase maturation"
FT                   /db_xref="EnsemblGenomes-Gn:PHG096"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85849"
FT                   /db_xref="GOA:O07451"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/Swiss-Prot:O07451"
FT                   /protein_id="AAP85849.1"
FT                   /translation="MLMPRRPRNPRTVRIRIRVRGVVQGVGFRPFVYRLARELGLAGWV
FT                   RNDGAGVDIEAQGSAAALVELRERLRRDAPPLARVDEIGEERCAAQVDADGFAILESSR
FT                   SDAAVHTAIGHDTAVCPDCLAELFDPANRRYRYAFINCTQCGPRYTLTWALPYDRATTS
FT                   MAPFPQCRPCLDEYNAPEHRRFHAEPNACPDCGPSLALLNAQGMPVEDVDPIAETVARL
FT                   QRGEIVAIKGLGGFHLACDAHNADAVARLRSRKQREEKPFAVMVANLATAAQWGDIGSG
FT                   EAALLTASERPIVLLRKRSGVDGRFAGVAPGLVWLGVMLPYTPLQYLLFHEAAGRPEGL
FT                   GWLAQPQSLVLVMTSANPGGEPLVTGNDEAAQRLTGIADAFLLHDREILVRCDDSVVRG
FT                   DGEPAPHVQFIRRARGYTPRAIKLARSGPSVLALGGSFKNTVCLTRGDEAFVSQHVGDL
FT                   GNAATCEALIEAVAHLQRVLEIRPQLVAHDLHPDFFSTRHAAELAAQWGVPAVAVQHHH
FT                   AHIAAVLAEHGSDEPAIGLALDGVGLGDDGQAWGGELLLVDGGACKRLGHLRELPLPGG
FT                   DRAAREPWRMAAAALHAMGRGEEIEGRFPRQPGAPMVNRMLAQRLNAPLSSSMGRWFDA
FT                   AAGLLGTRETMAYEGQAAMLLEGLAESWGEQPSPGRPKTVAHSLGGVPRSGGGTYKALA
FT                   LPDAWRIDAGNTLDLLPLLEALSAETNAARGAAQFHATLVAALEAWTVATVQVTGVRTV
FT                   VFGGGCFLNHILARNLCRRLAARGLTVLTARQLPPNDGGIALGQVWVALQRAPN"
FT   gene            89391..90581
FT                   /locus_tag="PHG097"
FT   CDS_pept        89391..90581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG097"
FT                   /product="hypothetical protein"
FT                   /note="similar to Escherichia coli hypothetical protein
FT                   (AAK09054)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG097"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85850"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAP85850.1"
FT                   /translation="MRISIQACIERAGEQPSKVIEVAVIERNADVAPASGLGLFIRESQ
FT                   EILRQLQTVVLTEQVDQFIRITGRCQLCGGRLVIKDTKSLVYRTAFGKARLRSPRFYSY
FT                   CSACGYCSSNKGTLSPLAQALPERVHPQWTWLQCRYASVMSYRLAQIFLRDAFAGGREL
FT                   PCSSVKLNVGRVGQRLEQEAQRATMVMSAVTAPPRSSPLTGTPIGLQIDAGYIKTPRQQ
FT                   DGKRWTPVVASKLIWPKTPRTHAHAYAVGHDPSQGLRQQAFLQSVGIGPQAPVTVISDG
FT                   GDDISFACKLPSATARVLDWYHIGMHKAKWLLWHGESKRCLERLESLRRDTGWVGARNP
FT                   LGRVIRYLRCCSRYLANYQQRRAQGLPISSAGAESVVDYVIGQRMKRNGHMRWTIL"
FT   gene            complement(90940..91158)
FT                   /locus_tag="PHG098"
FT   CDS_pept        complement(90940..91158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG098"
FT                   /product="hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22979938"
FT                   /db_xref="EnsemblGenomes-Gn:PHG098"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85851"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXM5"
FT                   /protein_id="AAP85851.1"
FT                   /translation="MNTNRRALVAVTTLAATLAAAPVFAKSGKFDTYTDGARSGKYDVY
FT                   TDGAKSGKFDTYTDGARYYIASDRAAL"
FT   gene            complement(91518..92678)
FT                   /locus_tag="PHG099"
FT   CDS_pept        complement(91518..92678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG099"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Ralstonia metallidurans gi:22975810"
FT                   /db_xref="EnsemblGenomes-Gn:PHG099"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85852"
FT                   /db_xref="GOA:Q7WXM4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXM4"
FT                   /protein_id="AAP85852.1"
FT                   /translation="MRLPSALSGRDGRNRAPTTGTRIAAGDDLAAVTAWLARYADSVAT
FT                   VATYRREVERLILWAVLQLGKPLSSLTHEDLLVYERFLADPQPAARWVLAGSKKLARNH
FT                   PDWRPFAGPLSPGSVRQALVILNALFAWLTEAGYLGGNPLALARRRRAPTQARITRYLS
FT                   HDLWDTVKDAVAAMPTETARERLHAARCRWVLTVLYLGGLRASELTATTMGAFFCRRDS
FT                   HGTERWWLEVNGKGNKIRLVPATDELIAELARYRRAYALPPTPQFGETRPLVLPVIGKA
FT                   GSEKALSRGALHLILKEVFGQAAARLRARGPEWEPQAAVLASASAHWLRHTAGSHMTDQ
FT                   QVDLRFVRDNFGHSSLSTTSGYLHSEEDARHEATQERHRIGWCSNN"
FT   repeat_region   93017..93024
FT                   /rpt_type=DIRECT
FT   mobile_element  93025..94337
FT                   /mobile_element_type="insertion sequence:ISAE1"
FT   repeat_region   93025..93067
FT                   /rpt_type=INVERTED
FT   gene            93039..94364
FT                   /locus_tag="PHG100"
FT   CDS_pept        93039..94364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG100"
FT                   /product="unknown"
FT                   /note="Orf2"
FT                   /db_xref="EnsemblGenomes-Gn:PHG100"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85853"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXM3"
FT                   /protein_id="AAP85853.1"
FT                   /translation="MSGLCGMRVDRGEVELSGDQEDHGAHGFEAHITAGLALGGLEQAV
FT                   ERLQEAIGLARLGPCNDTVEMLADHARDLLHWLDLGSHDVRAPLLEHCGNNVDLLALKD
FT                   FAQLLAIQPGTGSAFGRDVGDQRVEIGTLRGWQPVAILEQRPAQAFEAWIGLLFDTPGL
FT                   VHGCRSVSHDMELVEGDARVGQMLADALDERRRHVDTDHPDLLRRSVVLAQMCSELANR
FT                   GSILAFGHKHDLTRVGISDKRQVVVTAPVGRFVNGGSGHAGQIEFGHREVDIALADSVH
FT                   AMPRLTHRSGYSRKRHLLRKRHHHGFKQQREARELASPVRLDQHHAAVGKLHAWRADFQ
FT                   IAVVLEEVQVPIAFGHRVVNRVPTGDLRVGKAAAGDKVNLDRQRLGLRVEVDFPDEPRI
FT                   AYAKGCFKQFAMHRSCCSLPETRHDTTHLKFKRGTIPITPAG"
FT   gene            complement(93048..94274)
FT                   /locus_tag="PHG101"
FT   CDS_pept        complement(93048..94274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG101"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG101"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85854"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q79IP4"
FT                   /protein_id="AAP85854.1"
FT                   /translation="MHSKLFEAALGISDPWFVREVDFNAQTKTLTIQIDFVAGSRFSHP
FT                   EVAGGHPVHDTVTKRYRHLNFFEHDCYLEVRTPRVKLPDGRVVLVEPDWAGKLSGFTLL
FT                   FEAMVVALAQQMPFSAVARTVGESWHRVYAICERYVDLAVAELDLAGVTAAAVDETSYR
FT                   RGHNYLTLVADADARKVVFVTEGKDAATVGKFAAHLRENNAAPEQIGVVSIDMSPAFIK
FT                   GVSEHLPNARITFDKFHVVAHASAAVDKTRRIEQKTDPSLKGLRWTLLKDRDGLPAAQR
FT                   ADLDALIANVTTKRTARAWLYREQLREILERKQINVVSAMLEQWCTNVMRSKVEPMKEV
FT                   ARMIRKHFDGIVAWTQTRQTNGFLEALNGLFQAAKRKARGYVSFKTMRTVIFLIAGKLD
FT                   FSAINPHAA"
FT   repeat_region   94295..94337
FT                   /rpt_type=INVERTED
FT   repeat_region   94338..94345
FT                   /rpt_type=DIRECT
FT   gene            95015..96364
FT                   /locus_tag="PHG102"
FT   CDS_pept        95015..96364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG102"
FT                   /product="hypothetical protein"
FT                   /note="predicted by FrameD"
FT                   /db_xref="EnsemblGenomes-Gn:PHG102"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85855"
FT                   /db_xref="GOA:Q7WXM2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXM2"
FT                   /protein_id="AAP85855.1"
FT                   /translation="MQRVEMDAHKLDGRFCVSLPLMGGGFKEKIVHRLWVVVILEVVSR
FT                   AVLGYYFSVRREVSKDDVMRALKRALGRWCLRPVSFCDTPYLPEAGLLSALGSDFVGLC
FT                   WDETSVDGALAETCQHVRDALRDSVGSTLLDPKTSFSKRRSKDDRPFIESFFRNLAGQG
FT                   FQRLSNTTGANFQDRKGRQPEEVALASRFQYEYAEELLDVLIANYNATPHSGIGNRTPL
FT                   AYAKFLYHHSQQSFRRADPAIVDTLFSIRKRCIVRGGAKSGRAPFVEFHYGRYTNDVLH
FT                   NRHDLVGSEIWVVCHKEDDCRVALASTLDGMSLGVLRAAPPWNMSPHSLSLRAAICQAC
FT                   THGKFAIPAGVDAIDVFMRYVESQAHNRLPVHPAYLEARRILAAAAESSIGPSMLDAAM
FT                   ARTKAGSSSSNGSKGAAPEPTARRAQSGASDPLKPSAGSTLPPRRMAQSR"
FT   gene            96368..97348
FT                   /locus_tag="PHG103"
FT   CDS_pept        96368..97348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG103"
FT                   /product="hypothetical protein"
FT                   /note="predicted by FrameD"
FT                   /db_xref="EnsemblGenomes-Gn:PHG103"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85856"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXM1"
FT                   /protein_id="AAP85856.1"
FT                   /translation="MSFSLPERIDPRHCIVTKQYAVYTPPMHEMIEQIGEWIDQQRPGG
FT                   YIYGASRLGKSRCVQWYVANELQERFKAVMPLVVWNRRPDSQSSEAGFWHQLLLASRFE
FT                   FANPAKPPKKAEGIYLCKQRFIAIANNAQRNYVVLLIDEAQDLTLREWKWLVGLQNELD
FT                   YEGYLLSVFSVGSHQLNYRHEYMAITGNAHVAARFMAAHARFHGLRSPEEIGYVLNGYD
FT                   SDSEWPPSSGVPYLEHFAPADYAAGRRLAQCAAQLWKALMELSPESARRHFEFPMQHVA
FT                   KATEAILFQLARGEDWADVTSYESWLRELAKANFPDHMRIISTGG"
FT   gene            97479..98792
FT                   /locus_tag="PHG104"
FT   CDS_pept        97479..98792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG104"
FT                   /product="hypothetical protein"
FT                   /note="predicted by FrameD"
FT                   /db_xref="EnsemblGenomes-Gn:PHG104"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85857"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXM0"
FT                   /protein_id="AAP85857.1"
FT                   /translation="MEPDGCTPLPIDEIKRLASVLGEAAPLVEDVFSPSIRFIDVGRYG
FT                   PPPDSRERRAIRYCETCMQHGYHSYLHQLGWLSRCPFHLSELKTTWAQKHTASFVSQRV
FT                   GALEFVMRQRCRTWPHGIDAGFPAREQGRVASLAGWVARASVAAARMSLGEIWSSGNDG
FT                   MPGAVSLDQAFAQLRTLEPPPEDIEQLLIEAGDRWTLESHVFARQAKIQLGHLRLCHLS
FT                   FADVLHFYIRINAASANPSSFVTRLNAIQDRQARHGTCRCRWRLTKEGRLSRWVSVRPE
FT                   EGPRWGLICPYDIALNELQLGWGRSDLALSNRPAEQERRRFCSVSHAMRDLGLIRYTRD
FT                   AAVAPAGYLYADQDVWTCCEWVRESPLTAVLDMAVAWETELTFDALTTWLDDIDRGVAP
FT                   LERDDSKSCVRLRETDDGLLLIKWTRAEANVRRGLSRI"
FT   gene            99042..100253
FT                   /gene="kfrA1"
FT                   /locus_tag="PHG105"
FT   CDS_pept        99042..100253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kfrA1"
FT                   /locus_tag="PHG105"
FT                   /product="putative KfrA protein"
FT                   /note="similar to Pseudomonas sp. ADP KfrA protein
FT                   (AAK50247)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG105"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85858"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXL9"
FT                   /protein_id="AAP85858.1"
FT                   /translation="MPAVDLDLTDATLQADLAELRGRFPETRALYREVCGLLFFRYGVT
FT                   PTANKLYSLVRRGSMGTPAEVLQAFWQELRGRTRVTIDHPDLPEALKDIAAGAVQTIWQ
FT                   AANEAATGELATLRAEARHAASAAEAERDAARTETAAAREEVAAVSAQLAEARDAHAAV
FT                   QAELAAQRQAHAATQARLEAGREELDAAGRQLAELRTQFSTELERAREAVALAQERAEA
FT                   SERRSLRELDAERTARQQSERTAEALRGELVAARSEARDAAVAQAEVRARLEAQAAALA
FT                   DRLASAEQAQRKVAHDLDAVQAALAAAQRRAERAEAEAALARQLLAELRVTPPGRGDGG
FT                   GGRRRKAGSPAPTEQAAPREKLDDKQDGQQENDRQGVPTAASNPDDGSDSSDDSNDSAN
FT                   DRNQ"
FT   gene            100237..100506
FT                   /locus_tag="PHG106"
FT   CDS_pept        100237..100506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG106"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia solanacearum conserved
FT                   hypothetical protein (NP_522594); putative HNS domain (aa
FT                   43-88)"
FT                   /db_xref="EnsemblGenomes-Gn:PHG106"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85859"
FT                   /db_xref="GOA:Q7WXL8"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAP85859.1"
FT                   /translation="MTEINERAAAIRWIQAEMADYGLTMEELAAAGCFDPPPPPPPPLP
FT                   APAPPPVVCYRNAAGQTWDGQGDMPDWLQRAANAGQSVEFYRAG"
FT   gene            101129..102226
FT                   /locus_tag="PHG107"
FT   CDS_pept        101129..102226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG107"
FT                   /product="putative kinase"
FT                   /note="SMART domain SM00221; similar to Vibrio vulnificus
FT                   cmcp6 gi:27367537"
FT                   /db_xref="EnsemblGenomes-Gn:PHG107"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85860"
FT                   /db_xref="GOA:Q7WXL7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXL7"
FT                   /protein_id="AAP85860.1"
FT                   /translation="MALDISNLPQEAISALKQFPEFEIASFNDSGANGYVLIGRHSVLQ
FT                   KEVAIKIYFHGESDIDQEPTIIAKINHENVLKVYDARKVGKDCSYFMTPAASEGDLANF
FT                   LDTYFISLPLAHKLLCQLLSGIAALHMSPNLLVHRDLKPENLLVHNDNLLIADFGSVRR
FT                   IDEKTGSAPASKHSILYRPPEAFGEDSFFNFSSDIYQAGLIGFLLFGGSLSNDLLSYLT
FT                   KKQKSELTGIQGGYELSIYVDSCIEKKVSRGNLADFSTLPFYIPAAIKRTLRAAISSAD
FT                   KRYSSVSEFLAELSRLRGNMPDWSTRREGVLLRNWNGLDYRIPHDEVAILKCKSGAEKY
FT                   RYDKSYNCGSYAELFDQMKERLGLP"
FT   gene            102223..102753
FT                   /locus_tag="PHG108"
FT   CDS_pept        102223..102753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG108"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Rhodobacter sphaeroides gi:22956745"
FT                   /db_xref="EnsemblGenomes-Gn:PHG108"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85861"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXL6"
FT                   /protein_id="AAP85861.1"
FT                   /translation="MTYLWHTPALDLDLTDAPLQADLAELRARFPETRTLYREVCGLLF
FT                   FRYGVTPTDNKLYSQVHGQARRGAAGVLAGAAGTHARHHRPSRLAGDAEGHRGRGRGRP
FT                   SGRRPTRQPPPSWPRRAPNHRVGSGDAGRGAPGSRGDAGAAGAGAGGTGRRRQGAGNCV
FT                   RNSRPSLSVPASR"
FT   gene            103075..104100
FT                   /locus_tag="PHG109"
FT   CDS_pept        103075..104100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG109"
FT                   /product="putative ATPase"
FT                   /note="SMART domain SM00382; similar to Rhizobium etli
FT                   gi:21492959; AAA-family"
FT                   /db_xref="EnsemblGenomes-Gn:PHG109"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85862"
FT                   /db_xref="GOA:Q7WXL5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXL5"
FT                   /protein_id="AAP85862.1"
FT                   /translation="MASADQIKALVKSHIDQDDGKFYSIAMQVAAHEAKVGHGRFAVEL
FT                   RDMVDSAKQRAARPTAGQIVPIARPRGEIANLLHVSYPSNRLADMVLDDGGREQLQRIL
FT                   KEQRMLTRIREHGLSPRRKLLLVGPPGTGKTMTASVLAGELGLPLFLVRLDALITKFMG
FT                   ETAAKLRQVFDAISDVRGVYFFDEFDAIGSQRGMPNDVGEIRRVLNSFLQMIEHDQSNS
FT                   LIIAATNHPEILDYALFRRFDDVIEYHVPSVAQSALLLRSRLGSFAPKSLPLTALAETA
FT                   MGLSYAELRRAVDEAIKEALMHDEPKISTEALEAALVERKKLNQRLNNKNSQPHAGPAA
FT                   K"
FT   gene            104078..106576
FT                   /locus_tag="PHG110"
FT   CDS_pept        104078..106576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG110"
FT                   /product="conserved hypothetical protein"
FT                   /note="FrameD prediction picked ORF start at codon 60; ATG
FT                   picked further upstream based on BLASTP; similar to
FT                   Rhizobium etli gi:21492958, Agrobacterium tumefaciens
FT                   gi:16119897"
FT                   /db_xref="EnsemblGenomes-Gn:PHG110"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85863"
FT                   /db_xref="GOA:Q7WXL4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAP85863.1"
FT                   /translation="MPVPPQNKRRHLLPTGTSTSSPFTAHAANGRGRPVVPDLPRQQHG
FT                   QTLQAQIERLQAVAVAAHTEQAALGLSSGLGVQIQFASQPNVELAVQSLSAERGNPRSH
FT                   IELLSVRQDGEQTFASVFVPEGKLAHFEGYVADYLGEKKNKAGGPLDHKPLINTIAAIQ
FT                   PIEIRTLWTDEPELLPKDQDEGFWWEAWLPVRGNRNAVIGDFKALMQRAGCQVPDKQTD
FT                   FPERTVVLMYGSQNQVKTSLLSLNCVAEFRRAKETADFFDTMGVEEQRDWQQDLIQRTH
FT                   LAAAEDAPRLCLLDSGVNRGHELLAPLMAEDDMYSVEKDGRTDDEANHGTGMAGLGAYG
FT                   DLTEAIESNAPIAIYHRLESVRLLKEAGANAGEPELHAQLFGEAVSRPEISYPDRKRIF
FT                   CSAVTASDYRDRGRPSSWSAKVDSLAADADNEGQFPRLFVLSAGNTNDIDAWNAYPDSL
FT                   STNLIHDPGQAWNALTVGACTAKTTAHAGYEAIAEEGGLSPYSTTSAAWQSAWPLKPDV
FT                   VMEGGNVARDNFGAIGMDSLQLLSAHHLPRERVFTTFNATSAAAALCGKLASEIAAEYP
FT                   QMRPETIRALIVHSAEWTEGMRKAYLPAAQPGKAAYARLIRHCGWGEPSLDRALWSASN
FT                   SLTLVIEDALRPYKKERGVGPASREMNLHALPWPREELEALQGLPVQMRVTLSYFIEPN
FT                   PSARGSVSKYHYPSHRLRFDVQRPLDATTEAFVARVNAAVERDDEDPLNAADADWYLGD
FT                   RQRHRGSLHQDVWEGTAAELASRGVLAVYPAPGWWRTRPGLERFDSVANYSLIVSIRTE
FT                   QNQVDLYNAIANQIAIVNQV"
FT   misc_feature    104255
FT                   /locus_tag="PHG110"
FT                   /note="alternate site of translation initiation"
FT   gene            complement(106905..107963)
FT                   /locus_tag="PHG111"
FT   CDS_pept        complement(106905..107963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG111"
FT                   /product="conserved hypothetical protein"
FT                   /note="FrameD prediction picked ORF start at codon 127; ATG
FT                   picked further upstream based on BLASTP; similar to
FT                   Rhodobacter sphaeroides gi:22957917, Porphyromonas
FT                   gingivalis gi:03859861"
FT                   /db_xref="EnsemblGenomes-Gn:PHG111"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85864"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXL3"
FT                   /protein_id="AAP85864.1"
FT                   /translation="MFDDLRKPYADPNAPAASGPADSVKQIPDTDTGGDAAQRRYRQLC
FT                   NTANIPLFSQAWWLDATAGPGNWGVALVERGGQVVASLPYAPRRLYGFSVIAQPALAKM
FT                   AGPWLAPMAGKPARMLGQQKELMDELIGQLPRFDHFQQHWDPSQTNWLPFAWKGFRQTT
FT                   KYTYVLDDLSDTAALWNGMQHNIRGEIRKAGSRHGLQVRDDLGIDEFIQLNRQVFTRQR
FT                   MPLPYTDDYVRRLDAACAARGARKIFIAVDKQGYRHAGVYLVWDGQVAYYLMAGSDPKL
FT                   RTSGASSLCIWDAIRFASGVARTFDFEGSVLEPVERFFRGFGGRPQPYFFVQKTPSRIL
FT                   LTYLFLRSLRKP"
FT   misc_feature    complement(107585)
FT                   /locus_tag="PHG111"
FT                   /note="alternate site of translation initiation"
FT   gene            complement(110264..110935)
FT                   /locus_tag="PHG112"
FT   CDS_pept        complement(110264..110935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG112"
FT                   /product="putative transposase"
FT                   /note="similar to Bradyrhizobium japonicum gi:27379007"
FT                   /db_xref="EnsemblGenomes-Gn:PHG112"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85865"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAP85865.1"
FT                   /translation="MYTKRHFGARSVPSMLVPRSFDSNLVKRIGKVKKLRAPSCVFLAG
FT                   AEGVRSGDSHWRVAMLSRRLRWPLPNTARRRSSTPFRTASSPPHSSPTPCLAAASSCRG
FT                   TARAVGATTCSSNDFGAAYEEVYLKAYDSVSNARGSIANYVTWYNERRPYSSLETRSRI
FT                   RHTSPRCEQSKRQPDCTSASTYKLRLFVRTSETTSVAFRLLRGRTVRRPRKLSLNAGRK
FT                   C"
FT   gene            complement(110403..110738)
FT                   /locus_tag="PHG113"
FT   CDS_pept        complement(110403..110738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG113"
FT                   /product="putative transposase"
FT                   /note="similar to Burkholderia fungorum gi:22983463"
FT                   /db_xref="EnsemblGenomes-Gn:PHG113"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85866"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXL1"
FT                   /protein_id="AAP85866.1"
FT                   /translation="MAFAKYGTPEIVNTVQDSQFTAAQFTDAVLGRGIQLSRDGKGRWR
FT                   DNVFVERLWRSIRGGLSESLRLGQQCARIYRELRDLVQRTTTLFQSGDQIPDKAYFATL
FT                   RAIKAAA"
FT   gene            110971..111615
FT                   /locus_tag="PHG114"
FT   CDS_pept        110971..111615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG114"
FT                   /product="conserved hypothetical protein"
FT                   /note="FrameD prediction picked ORF start at codon 36; ATG
FT                   picked further upstream based on BLASTP; similar to
FT                   Mesorhizobium loti gi:13476738, Sinorhizobium meliloti
FT                   gi:15963938"
FT                   /db_xref="EnsemblGenomes-Gn:PHG114"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85867"
FT                   /db_xref="InterPro:IPR009758"
FT                   /db_xref="InterPro:IPR014581"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAP85867.1"
FT                   /translation="MTPWEIQGTELINCNCSYGCPCQFNALPTHGFCEAMGAISISNGF
FT                   YDVVRLDGVNIAVVFKWPGPIHEGKGKCQPVVDERASPEQRDAVLKIMSGQDTEPFATM
FT                   FSVFASTLEQAYDPIFTTIDFDVDVDARRGRIHVEGVFDIVGEPIRNPVTGAEHRARID
FT                   LPLGFEYEIAEIGSGTSRSQGNIALNLNSTYAQFARLHMNNKGLIRHHTAT"
FT   misc_feature    111076
FT                   /locus_tag="PHG114"
FT                   /note="alternate site of translation initiation"
FT   gene            111612..112400
FT                   /locus_tag="PHG115"
FT   CDS_pept        111612..112400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG115"
FT                   /product="conserved hypothetical protein"
FT                   /note="FrameD prediction picked ORF start at codon 38; ATG
FT                   picked further upstream based on BLASTP; similar to
FT                   Sinorhizobium meliloti gi:15963937, Mesorhizobium loti
FT                   gi:13476739; integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG115"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85868"
FT                   /db_xref="GOA:Q7WXK9"
FT                   /db_xref="InterPro:IPR018688"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAP85868.1"
FT                   /translation="MSCIENFLGRERVITALGIVAVIVSSWYYLWTGAGTGMAALDMTA
FT                   VALFPHRLADGGSMEMSLATVVVMWWTMMIAMMTPSAAPLILLYRRVIRYYGAPESRSL
FT                   VPSMLLLAGYLTAWLAFSICATWLQMILQPTGLISAMMLWSKSAVLSAIVLAAAGFYQF
FT                   TPLKRACLKQCRSPANFLTKHWRSGVAGSFLLGMRHGAYCVGCCCLLMTLLFVGGVMNV
FT                   LWIAALSLIVFVEKIVPGGDRLGRVLGAVLIAWAGVTLLA"
FT   misc_feature    111723
FT                   /locus_tag="PHG115"
FT                   /note="alternate site of translation initiation"
FT   gene            113703..115601
FT                   /gene="kup"
FT                   /locus_tag="PHG116"
FT   CDS_pept        113703..115601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kup"
FT                   /locus_tag="PHG116"
FT                   /product="putative potassium uptake protein"
FT                   /note="TC 2.A.72; FrameD prediction picked ORF start at
FT                   codon 20; ATG picked further upstream based on BLASTP,
FT                   similar to Ralstonia metallidurans gi:22978665, Ralstonia
FT                   solanacearum gi:17546340"
FT                   /db_xref="EnsemblGenomes-Gn:PHG116"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85869"
FT                   /db_xref="GOA:Q7WXK8"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WXK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAP85869.1"
FT                   /translation="MTQSATAHYFVESPSTGALVLGAVGVVFGDIGTSPLYALKECFSK
FT                   EHGIAFSPDAVLGVISILFWAMIIVVSIKYVVFVMRADNDGEGGVLALMALVLRTVAQR
FT                   SRKAKILMMLGIFGACMFYGDAVITPAISVLSAVEGLEIAAPQLSQFVIPITLVILAAL
FT                   FLIQRHGTAAVGKLFGPIMTTWFVALGALGILNLVQAPEILKSINPYYAISFLVEHALQ
FT                   AFIVLGSVFLVLTGAEALYVDMGHFGARPIRIGWFVLVMPCLILNYFGQGAMLLHNPAG
FT                   VENPFFLMVPELLQLPMVLLATSATVIASQAVISGAFSLTSQAIQLGFVPRMRVLYTSA
FT                   AEIGQIYLPVVNWLLLVLVIGVVISFKKSENLAAAYGIAVTTTMVITTFLAAVCMRNVW
FT                   KWDPALVAVLGTSFLLVDLAFFAANLLKIAEGGWFPLLLGSAAFFMLMTWYSGRKLLRA
FT                   RSLEDGIPLEPFIAGLLAHPPHRVEGTAVFLTGSIDTVPVSLLHNLKHNRVLHERVVFL
FT                   TFVTRDIPYVDDDQRVSCKDLGGGAFILKSEYGFKETPDVQKVLDLADRKLGMHFELME
FT                   TSFFIARESVIPSRLPGMPMWRESLFAWMHQNGAKPSDFFQIPANRVVELGTKVEI"
FT   misc_feature    113760
FT                   /gene="kup"
FT                   /locus_tag="PHG116"
FT                   /note="alternate site of translation initiation"
FT   gene            complement(115787..116041)
FT                   /locus_tag="PHG117"
FT   CDS_pept        complement(115787..116041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG117"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85870"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXK7"
FT                   /protein_id="AAP85870.1"
FT                   /translation="MPPYSPWRARQRTGANVDRVDAEARRGHAGIEQGYGDRIGFEAVV
FT                   VPETLFFRHREALLVLARFAAERANAEGTRTLLPLLPGG"
FT   gene            115880..116074
FT                   /locus_tag="PHG118"
FT   CDS_pept        115880..116074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG118"
FT                   /product="putative methyltransferase"
FT                   /note="similar to Myxococcus xanthus gi:21464490"
FT                   /db_xref="EnsemblGenomes-Gn:PHG118"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85871"
FT                   /db_xref="GOA:Q7WXK6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXK6"
FT                   /protein_id="AAP85871.1"
FT                   /translation="MPEEQGLGHHHRLEPYSIAIALLDAGVPTARFRIDAVDVSARALA
FT                   RAPWRVRRQRLPQWPAGFP"
FT   gene            115950..116207
FT                   /locus_tag="PHG119"
FT   CDS_pept        115950..116207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG119"
FT                   /product="putative methyltransferase"
FT                   /note="similar to Ralstonia solanacearum gi:17549866"
FT                   /db_xref="EnsemblGenomes-Gn:PHG119"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85872"
FT                   /db_xref="GOA:Q7WXK5"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXK5"
FT                   /protein_id="AAP85872.1"
FT                   /translation="MPACPRRASASTRSTLAPVRWRARHGEYGGNAFRSGPLDFRDRYF
FT                   TAGPAGYALDPRVRAQVRLPIHTTVVTDSPSATASWPERP"
FT   gene            complement(116161..116922)
FT                   /locus_tag="PHG120"
FT   CDS_pept        complement(116161..116922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG120"
FT                   /product="putative aldolase"
FT                   /note="Pfam entry PF03328; similar to Pectobacterium
FT                   chrysanthemi gi:16118728, Pseudomonas syringae pv. syringae
FT                   b728a gi:23468419"
FT                   /db_xref="EnsemblGenomes-Gn:PHG120"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85873"
FT                   /db_xref="GOA:Q7WXK4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXK4"
FT                   /protein_id="AAP85873.1"
FT                   /translation="MLQPNRLKAALAAGREVFGLLNSLPLPLVTEMIGYAGFDFVILDL
FT                   EHVGVNPQTLENMIRAAECAGITALVRVPRAAPDIILRVLDAGAQGIVVPHVRSRAEAE
FT                   LAVNSTRYHPLGTRGITGGRTTGFGTLTLPAYFQRANWELMVVAMIEDREGVDAIDEIV
FT                   AVPGIDMVLEGAIDLSQSFGVPADAQHPSVQAAIQRIAQACQARGVPFCAIPRAIGQCE
FT                   HWRELGVHAFLLGDDRATAFRAMKQLLTGYR"
FT   gene            complement(116909..118159)
FT                   /gene="lysA"
FT                   /locus_tag="PHG121"
FT   CDS_pept        complement(116909..118159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="PHG121"
FT                   /product="putative diaminopimelate decarboxylase"
FT                   /note="Pfam entry PF02784; similar to Xanthomonas
FT                   campestris pv. campestris str. atcc 33 gi:21232485"
FT                   /db_xref="EnsemblGenomes-Gn:PHG121"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85874"
FT                   /db_xref="GOA:Q7WXK3"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXK3"
FT                   /protein_id="AAP85874.1"
FT                   /translation="MAMTAPELRWSRVTDHLQNALANALANASAPLSTYVYDLEALRRH
FT                   ATATARGLPPGFELFYAIKANSDLPILQTLAPLAHGFEISSGGELAWVREHFADVPLIF
FT                   SGPGKTDAELAGALELGVEALHVESLHELERLAWLARARGVTAPVLLRVNLAIEGLQAT
FT                   TLMMGGKPTPFGIAGDQLPACLAWLRAHPEIRLRGFHFHLMSHQLDAAAHLRLLDAYLQ
FT                   QVRRWRAEYGLDTLDQVNVGGGIGVNYREPERQFDWAGFAEGLPALSAQRDGLTVRLEC
FT                   GRYITAFCGYYAMEVIDVKHAFDRAFVVACGGTHHFRTPYAQGHSHPFRVLPVESWRYP
FT                   FARPGVRDARVSVVGQLCTPKDVLAQDAPVDSVRAGDMVVFPYAGAYAWHISHHDFLRH
FT                   PHPQHCYLAAEDAHAAA"
FT   gene            complement(118150..119994)
FT                   /gene="iucA"
FT                   /locus_tag="PHG122"
FT   CDS_pept        complement(118150..119994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iucA"
FT                   /locus_tag="PHG122"
FT                   /product="putative iron transport protein"
FT                   /note="similar to Xanthomonas axonopodis gi:21243906,
FT                   Vibrio parahaemolyticus gi:23307118"
FT                   /db_xref="EnsemblGenomes-Gn:PHG122"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85875"
FT                   /db_xref="GOA:Q7WXK2"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXK2"
FT                   /protein_id="AAP85875.1"
FT                   /translation="MQVQTKMEHAGTRRVLTELAELAAARRCQETLLNCYCREVAAPAG
FT                   QLRVGPPAGHNDWPATIAMTLQREPAQVLEVQLPHIHGRLLSVVGGAWLTGNYRYLSPV
FT                   FHKAENKPWALLDWEALAALLLREMAQQHELPPNTELMEQIRNSVAVSTEVLSVPVPAT
FT                   IPADPVEAYIDSEQSLTFGHPFHPTPKSRQGFSDDDLLRYSPELRTRFPLAWFAVPRGD
FT                   IAQQSLRDASCDQLIAANAPAVPADRVAVPVHPWQAGYLREHPLVHDALASGRLQDLGT
FT                   QGADFFPTSSIRTLYQPGNPYFYKLSLNIRITNCVRKNAWYELESAMHVNRVLRPLLPD
FT                   LARLFPGLALMEEPAFLSVDLKDADTEQNRQVIEGFGLILRQSVDTLRAPDCVPLLAGS
FT                   LFGNHYYGEARMQRLLAALAAQAGTTVDAMTERWFSAYVSQLLYPVFHLFFAHGVIFEP
FT                   HLQNVVLGLRQDLPAQLFLRDFEGVKLTPSCHPASSMPELSERARSSLWYDEEQGWNRV
FT                   AYCLFVNNLCEVIAQLGGSRPAMTTRLWSVVRHHLHTYQHRYGNAASARRINGLLAGSP
FT                   FPAKTNFSNRFFQRADRASTYVPVANPIPFAGVEAAWQ"
FT   gene            complement(120023..121198)
FT                   /locus_tag="PHG123"
FT   CDS_pept        complement(120023..121198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG123"
FT                   /product="putative efflux protein"
FT                   /note="similar to Xanthomonas campestris gi:21232483,
FT                   Vibrio parahaemolyticus gi:23307117; transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:PHG123"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85876"
FT                   /db_xref="GOA:Q7WXK1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXK1"
FT                   /protein_id="AAP85876.1"
FT                   /translation="MSAGTRQVVAVVMLCHFIAAFAALGMPPFFALILQRSLHNDVPWL
FT                   AGAFYVVPTLLAALSAPWWGRLADRFGKKPLLMRAQLGLAASFLLASYATNSFAFLAAL
FT                   VLQGVLGGTFSASNAYLATVASGTTLTRSLTAMQWSARAALVAAPACLGLWMGAESPIV
FT                   LYRWLALLPLAAAALIAWLPAGEATGAAKRPATRAGGASVSAPATPRQIYVLQFAFVFA
FT                   TVVTFPYFIPDMQQRMPAISAATAGLLFGLPHLVYLAAAPLLSRRLGLAPSLGLLATAY
FT                   GTLVIALLAQAAPLGLPALVAWRLLMGIAMTAGFIALHALVASVVHAGNAGRTFGWFES
FT                   SSKWGGVVAGLGAGAAVSLAGQRAPYLLGAALLAPAVAYLLLTARQRISAL"
FT   gene            complement(121195..123012)
FT                   /locus_tag="PHG124"
FT   CDS_pept        complement(121195..123012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG124"
FT                   /product="putative siderophore biosynthesis protein"
FT                   /note="similar to Xanthomonas campestris pv. campestris
FT                   str. atcc 33 gi:21232482"
FT                   /db_xref="EnsemblGenomes-Gn:PHG124"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85877"
FT                   /db_xref="GOA:Q7WXK0"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXK0"
FT                   /protein_id="AAP85877.1"
FT                   /translation="MTACLPEEPGLSAAPDADAAYICVRVVDTLLREDVRACASRGELR
FT                   DTAAIPAATAHGFDAGQQWLRVAHLGAGTVWIPVTPARYMQEWRLTRPPLLREDAGAFA
FT                   ALHDVDAILAAFAGDLPAEDARLFTAYADECRAAVEHRKASMAERARWFAQPHSADGHA
FT                   LPAWDQRMLHYDRVAGFLDHPYYPTARAKLGFAASDLARYAPEFQPAFALNWLAVPRER
FT                   HHPSGDALPPNWPDFADVGLDPALAASHALVPVHPFVWQHHLDGFMAEAGLDCQVIRAP
FT                   RTYLRVSPTLSVRSLVLLDAPAWHVKLPLTIRTLGARNIRTIKPSTIGDGHRIQSLLGD
FT                   IVRREPGLNGQVLFTDEANGAHVDQRPFLGYILRRYPEQQLANATVVSVAGLLAETASG
FT                   NCVAEALAGRYHGGDLDAWFDAYLALTLQLHLTLWLRYGIALESNQQNSMLVYSDDGLR
FT                   LLLKDNDAARIDRGTLGRRWPALAARLDGLEDQRIGVAEALPLAQMFVTITLQLNIAAL
FT                   VEGLAQRRGTDPAAGYARVRDHVAAVLADLAAAGEDTGFARQVLLDDDRLHLKYLLTAA
FT                   SLVEKAQTGATDVNKFYGKRAPNFLRVAA"
FT   gene            complement(123009..124214)
FT                   /locus_tag="PHG125"
FT   CDS_pept        complement(123009..124214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG125"
FT                   /product="putative siderophore biosynthesis protein"
FT                   /note="FrameD prediction picked ORF start at codon 32; ATG
FT                   picked further upstream based on BLASTP; similar to
FT                   Azotobacter vinelandii gi:23101930, Xanthomonas campestris
FT                   pv. campestris str. atcc 33 gi:21232481"
FT                   /db_xref="EnsemblGenomes-Gn:PHG125"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85878"
FT                   /db_xref="GOA:Q7WXJ9"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAP85878.1"
FT                   /translation="MQEIFVLAHVPTAPINEGFLPAARALGLSVVMLTDCADAHRAHFA
FT                   SAGLPAYPDDIVPCDVFNPLAAIDAITRRGGKPGAVFSNSDHLQTATAIAAAYFGLPGK
FT                   DWRTTYAAKNKAEMRRRLAESGIDTLWHAVVCDTAGLTALADVPMPCIVKPREGVASQQ
FT                   VSLARSHAELAEHCGAIWVRHPGQALLLEEYLEGPLYTLETLGDGKEIRALGGFRVTLS
FT                   PPPYFVELEAVWGTGLPASVEAEVLDTIRRFGIGFGACHTEYVLTPKGPRLIEINYRSI
FT                   GDYREFLLSDTLQFPLFEQVLRLHLGEALPALEVPKRAAWIRYFTAQAEGTLRHAPCHS
FT                   QHEGDGVRLTYQPLRKVGDAIQLTNSNKDYLGVLRGSGPDLKGLAAAVEMASSKLAWEI
FT                   TQ"
FT   misc_feature    complement(124121)
FT                   /locus_tag="PHG125"
FT                   /note="alternate site of translation initiation"
FT   gene            complement(124402..126537)
FT                   /locus_tag="PHG126"
FT   CDS_pept        complement(124402..126537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG126"
FT                   /product="probable ferrisiderophore receptor protein, TonB
FT                   dependent"
FT                   /note="FrameD prediction picked ORF start at codon 25; ATG
FT                   picked further upstream based on BLASTP and SD sequence;
FT                   similar to Pseudomonas putida kt2440 gi:26990323, Ralstonia
FT                   solanacearum gi:17549283; Pfam:TonB_boxC"
FT                   /db_xref="EnsemblGenomes-Gn:PHG126"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85879"
FT                   /db_xref="GOA:Q7WXJ8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAP85879.1"
FT                   /translation="MSRRMRIKLHPICAAVAGTFVFQPMAAWSQATPTAAAQLPEVTVK
FT                   ADVSRELGAGYNPPNALSATKTEAPLRDVPQTVNVVTAEVMRDQHATSMQDALKNVPGV
FT                   SFSHGDGQRDQVSIRGFTAIADQFVDGIRDDALYFRDLSNVDRVEVVKGPAAVLYGRGS
FT                   AGGLINRVTKKPGIDVTDFALSYGMWADRRAEADVGRVFADGAAAFRITGAVEKANSYR
FT                   SQQFLDRKAIAPSLELRVAPETTVLFQADYLEDRRVTDFGIPAYQGRPVDVPASRYYGA
FT                   ANARDADYSQSRVFSGTATINHRFNQNWSIRNATRYYHYSLDRNNTLTSAVNEAARTLT
FT                   MNHGNVRREEHGWFNQTDLTQKATFLGMEHEILYGMEIGQQNKDQVNNTKPVLGANGRP
FT                   AVFDLFNPVLMTLPLKAPGNPTTSNLGVFDTLAFYTQDMIKFSEQWKALVGVRYDNFQQ
FT                   ETRNRIAGQRDLSRTDTAWSPRAGLVWQPSKAQSYYVSWSKSFQPSGEAFALAANNADL
FT                   APETTNNTEVGAKYDWLNGKASTTISVFRLERSNIKVANATNTALLPIGEQRTDGIEIS
FT                   GAAELGGGWRMLAGYAYLDATITKSTAALQGKRATITPRHSGNAWVTKDLGHGFGVGAG
FT                   LNLVGARYADPLNTVTLPGYVTADAMAWYRRGAFEAQLNVYNLFDKGYIVSAHGTSSNL
FT                   NMPGAPRSVMATLRYRM"
FT   misc_feature    complement(126465)
FT                   /locus_tag="PHG126"
FT                   /note="alternate site of translation initiation"
FT   gene            126956..127276
FT                   /locus_tag="PHG127"
FT   CDS_pept        126956..127276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG127"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia solanacearum gi:17548929,
FT                   Ralstonia metallidurans gi:22978149"
FT                   /db_xref="EnsemblGenomes-Gn:PHG127"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85880"
FT                   /db_xref="InterPro:IPR024446"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXJ7"
FT                   /protein_id="AAP85880.1"
FT                   /translation="MQKILAVCAIAAASILVSGTAQARVDVGIGIGIPGVVIAAPPPPV
FT                   YYEPAPVYVAPRPVIVAPPPGYYDDDWQARAWREEQWREQRWREREWRERHRRWHRWHD
FT                   DD"
FT   gene            complement(127980..128120)
FT                   /locus_tag="PHG128"
FT   CDS_pept        complement(127980..128120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG128"
FT                   /product="putative transposition protein"
FT                   /note="similar to Pseudomonas syringae pv. syringae b728a
FT                   gi:23471514"
FT                   /db_xref="EnsemblGenomes-Gn:PHG128"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85881"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXJ6"
FT                   /protein_id="AAP85881.1"
FT                   /translation="MSLLQSARLNGHDPYAYLKDVLTRLPTQPASRLEELLPHHWQLPQ
FT                   S"
FT   stem_loop       128214..137807
FT                   /note="IR16-2"
FT   stem_loop       128214..131315
FT                   /note="IR16-2"
FT   gene            128344..129576
FT                   /locus_tag="PHG129"
FT   CDS_pept        128344..129576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG129"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Ralstonia eutropha plasmid pAE1-encoded
FT                   putative integrase/recombinase gi:02120948"
FT                   /db_xref="EnsemblGenomes-Gn:PHG129"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85882"
FT                   /db_xref="GOA:Q7WS65"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WS65"
FT                   /protein_id="AAP85882.1"
FT                   /translation="MNATRTVSESGGLPAHHIDAFLDRLRTAHYSEVSLRKKRRVLCVF
FT                   SGWMKNRNIDLIDLDESVTARFMNRMIDASRDRVQRARPTLRQFLAYLRAEAIVCSPTL
FT                   GGQSEIARIYRRYLDHLRQDRGLAKNSLLVYGPFIRDFLDSHSANDGTILADAFCAVTI
FT                   RDHFLTYSEGRSAEYTRLMAVALRSFCHFLFLRGDTARDLYESVPSVRKWRQSTVPTFL
FT                   TPEQQEALIASADRSTPTGRRDYAILLLLARLGLRAGEIVAMQLDDIHWRSGELVVHGK
FT                   GQMVEHVPLPSEVGAAIATYLRDGRGASASRHVFLRRLAPRVGLAGPAAIGKIVCQAFA
FT                   RAGFRPACRGSAHLFRHGLATTMIRHGASIAEIAEVLRHRSPDSTAIYAKVAFEDLRGV
FT                   ARSWPTAGGAI"
FT   gene            129573..130520
FT                   /locus_tag="PHG130"
FT   CDS_pept        129573..130520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG130"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Mesorhizobium loti gi:13474968"
FT                   /db_xref="EnsemblGenomes-Gn:PHG130"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85883"
FT                   /db_xref="GOA:Q7WS22"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WS22"
FT                   /protein_id="AAP85883.1"
FT                   /translation="MTSIRDSLARYVAVRRALGASFYEPALALGHFVDLLEHEDAEFIT
FT                   TDLALRWAMTPALVERATWGRRLSQVRGFARWMNVIDGRNQIPPAGLLSARRRRNAPHI
FT                   YTEQEIDLLMTRAAQLRSRTGMRALTYSTLIGLLVATGLRPGEALRLDRSDVDLVSGIL
FT                   SIRESKFGKSRFVPVAESTRVALEHYAKKRDQLCPSRLSEAFLVSERGKRLKAGTARSM
FT                   FVRMSRAVGLRSATEDGRDGYGPRLQDFRHSFATGRLVEWYRAGLDVSRELPKLAAYLG
FT                   HVNIGLTYWYIEAVPELLELAAAYLDKDCPGERP"
FT   gene            complement(130609..130767)
FT                   /locus_tag="PHG131"
FT   CDS_pept        complement(130609..130767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG131"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85884"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WS52"
FT                   /protein_id="AAP85884.1"
FT                   /translation="MLRVRTELPLPCSRCCRNSSINDTSKSSIRSFDGARPICLVANAS
FT                   SSRNVSR"
FT   gene            complement(130670..131194)
FT                   /locus_tag="PHG132"
FT   CDS_pept        complement(130670..131194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG132"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia eutropha plasmid pAE1-encoded
FT                   hypothetical 21.6 kDa protein gi:02120946"
FT                   /db_xref="EnsemblGenomes-Gn:PHG132"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85885"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WS17"
FT                   /protein_id="AAP85885.1"
FT                   /translation="MTTARTGEDRITWFAWLIQQPLFQDGNYIRSQRSASHLSAFAKAT
FT                   NVGACAERHILTPECGQFAIAQTRLNRYKKQRSVAVADPVSYVRRPYQSGGLALGQKLN
FT                   WAVLAAFGWDCKNALTLQKQRRLADCDEPEEGMHGGKPRVACAHRIASAVFEVLQEFLD
FT                   QRHVEVLDSEL"
FT   gene            131084..131452
FT                   /locus_tag="PHG133"
FT   CDS_pept        131084..131452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG133"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Mesorhizobium loti gi:13474966"
FT                   /db_xref="EnsemblGenomes-Gn:PHG133"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85886"
FT                   /db_xref="GOA:Q7WXJ5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXJ5"
FT                   /protein_id="AAP85886.1"
FT                   /translation="MRCTPLRPDVVAVLKQWLLYQPGEPGDPVFPSSRGGHLSADALQR
FT                   LVSRNAEIARLSCPSLKKKSITPHTLRHYMPFPTMSCNRKIALYFMGKRMHGDRDSLDS
FT                   FLQPQSIREGVHHEIHHP"
FT   stem_loop       131316..134705
FT                   /note="IR16-2"
FT   gene            131433..132671
FT                   /locus_tag="PHG134"
FT   CDS_pept        131433..132671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG134"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Rhizobium sp. ngr234 gi:16519919"
FT                   /db_xref="EnsemblGenomes-Gn:PHG134"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85887"
FT                   /db_xref="GOA:Q7WXJ4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXJ4"
FT                   /protein_id="AAP85887.1"
FT                   /translation="MRYTIHDRVVLAHAPEGPLASHIVAFANSIAVQGYSTQSLKYHVR
FT                   LVAGFSRWLGRNGIDLHNVCPDHSAQYLRYRARHVRPGPGDRAALRHLIDFLDRERLIS
FT                   AQRMPERRLTPIESCTQAYVEYLHEARALSKATIVNYVPFIREFLEDCFGDGRIRLSRL
FT                   RAGDVVNFVQCQALRLHLKRAKLMTTALRSFLRYACYRGDMTLDLAAAVPVVANWSMQS
FT                   IPRGIPPEQIQQLLVSINRRTAVGRRDYAIILLLARLGLRSGEVAFLELDDIDWNTGVL
FT                   SVRGKSGQRNGLPLPADVGKAIAAYLRDGRPQSTSRRVFLRAKAPVIGFRGASGVGSIV
FT                   RHSLQRAGIDAPTTGAHQFRHGLACQMLSHGASLSEIGELLGHHHPQTTKIYTKVDIKA
FT                   LRTLAVPWPGGVR"
FT   gene            133103..133612
FT                   /pseudo
FT                   /locus_tag="PHG135"
FT                   /note="putative integrase/recombinase; similar to Rhizobium
FT                   sp. ngr234 gi:16519920"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            133609..134607
FT                   /locus_tag="PHG136"
FT   CDS_pept        133609..134607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG136"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Rhizobium sp. ngr234 gi:16519921"
FT                   /db_xref="EnsemblGenomes-Gn:PHG136"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85888"
FT                   /db_xref="GOA:Q7WRQ5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WRQ5"
FT                   /protein_id="AAP85888.1"
FT                   /translation="MTTTASLAPLLERFFTQRLMQQRQASPHTISSYRDTFRQFLKFAQ
FT                   QRLHRQPSRMNFEEIDAPLIVAFLDDLEQRQGVSVRSRNLRLTAIHSFFRYAALETPAH
FT                   SAQIQRVLAIPSKRFTRTLVQFLTRQEVDALLAAPDQRTWAGRRDHAFLLVAVQTGLRL
FT                   SEMTGLKRDDLVLGTGAHVRVIGKGRKERCTPIVRSTLAVLKAWLREPQRGEDDVLFPS
FT                   ARGERLTVHGVQYLLNKHRETASKICPSLKQKQVTVHRLRHTMAMDLLQAGVDRSVIAL
FT                   WLGHESVETTQIYLEATLAMKEQALAKTSLAHGKPGRYRPADELLGFLNGL"
FT   gene            complement(134341..134937)
FT                   /locus_tag="PHG137"
FT   CDS_pept        complement(134341..134937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG137"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Mesorhizobium loti gi:13474966"
FT                   /db_xref="EnsemblGenomes-Gn:PHG137"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85889"
FT                   /db_xref="GOA:Q7WXJ3"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXJ3"
FT                   /protein_id="AAP85889.1"
FT                   /translation="MRCTPLRPDVVAVLKQWLLYQPGEPGDPVFPSSRGGHLSADALQR
FT                   LVSRNAEIARLSCPSLKKKSITPHTLRHYMPFLTISGNEGFASVLVRCALVVEPSPVTT
FT                   RHSFVALQSIQEAEKFVCRPVASWLAVSQRCLRKSLLLHRKCRFEIDLRGFHRFMPEPQ
FT                   CNHGTINARLQKVHGHRMPQTVNGDLFLLQRWTNF"
FT   stem_loop       134706..137807
FT                   /note="IR16-2"
FT   gene            134827..135351
FT                   /locus_tag="PHG138"
FT   CDS_pept        134827..135351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG138"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Rastonia eutropha plasmid pAE1-encoded
FT                   hypothetical 21.6 kDa protein gi:02120946"
FT                   /db_xref="EnsemblGenomes-Gn:PHG138"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WS17"
FT                   /protein_id="AAP85890.1"
FT                   /translation="MTTARTGEDRITWFAWLIQQPLFQDGNYIRSQRSASHLSAFAKAT
FT                   NVGACAERHILTPECGQFAIAQTRLNRYKKQRSVAVADPVSYVRRPYQSGGLALGQKLN
FT                   WAVLAAFGWDCKNALTLQKQRRLADCDEPEEGMHGGKPRVACAHRIASAVFEVLQEFLD
FT                   QRHVEVLDSEL"
FT   gene            135254..135412
FT                   /locus_tag="PHG139"
FT   CDS_pept        135254..135412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG139"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85891"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WS52"
FT                   /protein_id="AAP85891.1"
FT                   /translation="MLRVRTELPLPCSRCCRNSSINDTSKSSIRSFDGARPICLVANAS
FT                   SSRNVSR"
FT   gene            complement(135501..136448)
FT                   /locus_tag="PHG140"
FT   CDS_pept        complement(135501..136448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG140"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Mesorhizobium loti gi:13474968"
FT                   /db_xref="EnsemblGenomes-Gn:PHG140"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85892"
FT                   /db_xref="GOA:Q7WS22"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WS22"
FT                   /protein_id="AAP85892.1"
FT                   /translation="MTSIRDSLARYVAVRRALGASFYEPALALGHFVDLLEHEDAEFIT
FT                   TDLALRWAMTPALVERATWGRRLSQVRGFARWMNVIDGRNQIPPAGLLSARRRRNAPHI
FT                   YTEQEIDLLMTRAAQLRSRTGMRALTYSTLIGLLVATGLRPGEALRLDRSDVDLVSGIL
FT                   SIRESKFGKSRFVPVAESTRVALEHYAKKRDQLCPSRLSEAFLVSERGKRLKAGTARSM
FT                   FVRMSRAVGLRSATEDGRDGYGPRLQDFRHSFATGRLVEWYRAGLDVSRELPKLAAYLG
FT                   HVNIGLTYWYIEAVPELLELAAAYLDKDCPGERP"
FT   gene            complement(136445..137677)
FT                   /locus_tag="PHG141"
FT   CDS_pept        complement(136445..137677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG141"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Ralstonia eutropha plasmid pAE1-encoded
FT                   putative integrase/recombinase gi:02120948"
FT                   /db_xref="EnsemblGenomes-Gn:PHG141"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85893"
FT                   /db_xref="GOA:Q7WS65"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WS65"
FT                   /protein_id="AAP85893.1"
FT                   /translation="MNATRTVSESGGLPAHHIDAFLDRLRTAHYSEVSLRKKRRVLCVF
FT                   SGWMKNRNIDLIDLDESVTARFMNRMIDASRDRVQRARPTLRQFLAYLRAEAIVCSPTL
FT                   GGQSEIARIYRRYLDHLRQDRGLAKNSLLVYGPFIRDFLDSHSANDGTILADAFCAVTI
FT                   RDHFLTYSEGRSAEYTRLMAVALRSFCHFLFLRGDTARDLYESVPSVRKWRQSTVPTFL
FT                   TPEQQEALIASADRSTPTGRRDYAILLLLARLGLRAGEIVAMQLDDIHWRSGELVVHGK
FT                   GQMVEHVPLPSEVGAAIATYLRDGRGASASRHVFLRRLAPRVGLAGPAAIGKIVCQAFA
FT                   RAGFRPACRGSAHLFRHGLATTMIRHGASIAEIAEVLRHRSPDSTAIYAKVAFEDLRGV
FT                   ARSWPTAGGAI"
FT   gene            complement(137742..139190)
FT                   /locus_tag="PHG142"
FT   CDS_pept        complement(137742..139190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG142"
FT                   /product="putative transposase, IS66 family"
FT                   /function="transposition"
FT                   /note="Pfam PF03050; similar to Magnetococcus sp. mc-1
FT                   gi:23001527"
FT                   /db_xref="EnsemblGenomes-Gn:PHG142"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85894"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXJ2"
FT                   /protein_id="AAP85894.1"
FT                   /translation="MPSTPVTVTAAELQLLRDAERELKAILAEREAIKGELRVMTVQRD
FT                   LLLEQLKAFQRKLFAAKSEARGSEQKDLFLNEAEAMAAAAAQPAQEEEGTPETEVAGHT
FT                   RKKRGRKPLDPALPRVEVRHELPESERVCPLDGQTLVEIGVEVSEQLDIVPQQVRVIQH
FT                   QRVKYACPCCDGGIKTTPAPARIIPKGLLTESALAWCITSKYQDGLPLYRQAALLHRFG
FT                   GDLSRGTLAASIVRVGQAVQPIINLLRDHLLEADVVYGDETTVQVLKEPGRPAQRKSFL
FT                   WAQMNGTGPPVRLFAYSPTRETKQATALYAGIKPGAVLMTDGYAPYDDVANTYQLVHLG
FT                   CWAHARRYLVEAEQALPKDKRADHTVTGFLQRIGKLFAIERHTLEMRPEQRQQVRAEQS
FT                   QPLLAEIETMLLQHLHTVLPQSLFGKALHYLHGQWPKLVRYIENGTWPISNNAVHAASG
FT                   MNRVMPAPRLCRVVHAHDGGYGLS"
FT   gene            139184..139393
FT                   /locus_tag="PHG143"
FT   CDS_pept        139184..139393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG143"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85895"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXJ1"
FT                   /protein_id="AAP85895.1"
FT                   /translation="MAWRVRPLPPSSVHAARWYSRCGCRRIASMSIPSSSQCNCSTVSV
FT                   ATDASRGQANRSASNRFNSSQKPL"
FT   gene            complement(139222..139572)
FT                   /locus_tag="PHG144"
FT   CDS_pept        complement(139222..139572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG144"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Burkholderia fungorum gi:22982816;
FT                   secreted or periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PHG144"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85896"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXJ0"
FT                   /protein_id="AAP85896.1"
FT                   /translation="MFRLDAGLRVYLHRDAVDFRKNINGLALLVEQALGLDPFASAVFV
FT                   FRNQRADRIKILGWDHNGFWLLLKRLEADRFAWPREASVATLTVEQLHWLLEGIDIEAM
FT                   RRHPHREYHRAA"
FT   mobile_element  139610..142972
FT                   /mobile_element_type="insertion sequence:IS882"
FT                   /note="member of the Tn3 family"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   repeat_region   139610..139644
FT                   /rpt_type=INVERTED
FT                   /note="IS882 terminal IR"
FT   gene            139764..142703
FT                   /gene="tnpA"
FT                   /locus_tag="PHG145"
FT   CDS_pept        139764..142703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PHG145"
FT                   /product="putative transposase"
FT                   /note="Pfam entry PF01526; similar to Pseudomonas sp. adp
FT                   gi:13937463"
FT                   /db_xref="EnsemblGenomes-Gn:PHG145"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85897"
FT                   /db_xref="GOA:Q7WXI9"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXI9"
FT                   /protein_id="AAP85897.1"
FT                   /translation="MSAFAYRYVGREELPARLTEFDLRQFFQLTSADIAAIRERFRADR
FT                   YAAVGLQLVCLRAFGRPLDRFAAVPRNLLQYVCETFSVPLLSIASLKTLYQRRPTLYEH
FT                   QQWVKEHLGIKPFDDTSQAALLEMLRVQAAAAADVDELVTTAQRWLYDRCRLIPGQRQI
FT                   TDMARHAFSAYEAQMLAAVNRAVPAATLQHCMESVRSPRADGSATHLEWIKAPSRRNGP
FT                   KNLAETLDKIRYLKSLAVHEWNLDDIALPKLRAYAQKVQARRPAKTKALKESTQALELV
FT                   CFLRMSLLELTDIAMHQTSRRSQDLFRRAASTAQSTHTRSAVEDRQQALKAKAVLQDKS
FT                   KSTEQRVDEALKHLAVVTDAAHSSFASHVRAALTGDHQRIHALLSGLEGLEFGGREDDP
FT                   GFANLKAWRDLQTRKLNALPEDFTESGVGTAWHDLVHDPDPKRGYQAFSACTMMSLRNS
FT                   LRRGSVWIDHSMRFRDRDQMLIPAKEWERDRVKYLGLLGLPAAADTYIEQLLDTLRAGV
FT                   AAVAEATANGKIEIGDDGMLHLPAIVPLEQDDEPRRTRDLIYKTIGDVQLPDLLLEVDA
FT                   STNFSEVLLGHRAKSVPELLSTYAALLAHGTEIDAKGIAAMIPGIDTAQVSLAMRGLET
FT                   HGRLRRANEVVAEFQGKIPLATNWGTGQKASADMMSLDVSRHLWIARVDPRRRTYATGI
FT                   YTHVLDKWGIVYDQPIVLNERQAGVAIEGVEQHNRCEDRIRLSLLAVDTHGYTNAAMAW
FT                   AKGLSFDLCPRLRDLSERKLYLPAEFKVPEGIERVTTKRLSLRAIRLGWDDFLRVLASI
FT                   RIGRISAELAMQRLGSAARTNRAHKAAEHLGRLLRSIFLCDYVTIEDFRREIHTLLSRG
FT                   ESVHQLQRAIHAGRVPHERGRRGDEMTAISGAHALLTNIVLAWNTHRMNDVVERLRKGG
FT                   TNIEDAWLRRMGPGHSGHINFRGILSFGVERYIDALIRGSGATTRRAMA"
FT   repeat_region   142938..142972
FT                   /rpt_type=INVERTED
FT                   /note="IS882 terminal IR"
FT   gene            143140..143640
FT                   /locus_tag="PHG146"
FT   CDS_pept        143140..143640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG146"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Burkholderia fungorum gi:22983421"
FT                   /db_xref="EnsemblGenomes-Gn:PHG146"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85898"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXI8"
FT                   /protein_id="AAP85898.1"
FT                   /translation="MLQNTVATLQKQQKDYYADLDARLKKFEPQHASVEDRQGTSQPGE
FT                   KPEYDAALKHFQAGDFKSAGNAFSSFIKKYPQSPYLPLAQYWLGNSLYAQRDYKGSTWV
FT                   LHKMIDANPRHPKVPDAMIAVANNQLESGQKAAGRETLEQVVAKYPGTEGARAADNRLK
FT                   TLK"
FT   gene            144004..144762
FT                   /locus_tag="PHG147"
FT   CDS_pept        144004..144762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG147"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Escherichia coli o157:h- gi:18026930"
FT                   /db_xref="EnsemblGenomes-Gn:PHG147"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85899"
FT                   /db_xref="InterPro:IPR026001"
FT                   /db_xref="InterPro:IPR040508"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXI7"
FT                   /protein_id="AAP85899.1"
FT                   /translation="MATFDDLMDDAALRGKLLLAMRKALVARFEKLDWIDLGFEHEIGI
FT                   KQRILQGSQFKSNDDYPDLVHDLLVRLYSEKPAVLKALVLHPRLQSAIEADVPQVVAAV
FT                   SGTPHVTVAAADAESSSEIVVRALRDAETLIRSGGGAESAVDRLHTALHGYLRHVCSEA
FT                   GLSYADGATIGDLFKLLRERHPAFANDGPHKKEVDRIRRGMGQILDTLGTLRNHASMAH
FT                   PTEALLARVDAELTLNAARTVFNYIAATIA"
FT   gene            144890..145660
FT                   /locus_tag="PHG148"
FT   CDS_pept        144890..145660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG148"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Escherichia coli o157:h- gi:18026930"
FT                   /db_xref="EnsemblGenomes-Gn:PHG148"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85900"
FT                   /db_xref="InterPro:IPR026001"
FT                   /db_xref="InterPro:IPR040508"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXI6"
FT                   /protein_id="AAP85900.1"
FT                   /translation="MFLALEKLLGDDAKRNKAFATFAKVLERRFSESDWASFGHEHNIE
FT                   EIYGNDHLLRSAQYGNSDYRLCILRTLEFLFDDYAKALKALLTDASLHNTLKREDPDLY
FT                   AIVTDEEVPHVPAKKPRRSKLEVVRKALHDAETLLASGGPTSAVDRVHTALHGYLREVC
FT                   DKAKLSYGAQPTVTELYKLIRTEHPAFDAKGTHAEAIKKVANGMASTLDGLNTLRNQAS
FT                   VAHPNEDLLDDVDAGLAVNAARTVFNYVAGKVGD"
FT   gene            145993..146925
FT                   /locus_tag="PHG149"
FT   CDS_pept        145993..146925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG149"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85901"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXI5"
FT                   /protein_id="AAP85901.1"
FT                   /translation="MEIQTISTQDGVTRIDRRDSEPRIRFSPFHGDTNAEASERRAAAI
FT                   FGPVEICDPWTSAPPSPEQIARIVVLHGVYRPPKTFLPSSPFQLVPSEFLRVAKQRPPR
FT                   QPGASASAFAQWIYSLYASSEGSDDDRESGLAAEPEILAFRHRALRLVDADYLHQQHAA
FT                   WELAHCGLHHGADTMVSYFHLDDLRVNGEPLRASPDLVYRHKTTGEVIVVEIKMSRMAI
FT                   PSNLWPNVWGQLWCYAQLPVVRAASRVTVVGEVWAERSEHSRGQGDDWQRLPPYLYLRA
FT                   SVRRDPREAVYDRFFRALFDIYRGAGGGR"
FT   gene            complement(147471..148217)
FT                   /locus_tag="PHG150"
FT   CDS_pept        complement(147471..148217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG150"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Micrococcus sp. 28 gi:18025393"
FT                   /db_xref="EnsemblGenomes-Gn:PHG150"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85902"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXI4"
FT                   /protein_id="AAP85902.1"
FT                   /translation="MQRNRAARHRNGVGIQQRLDLATDWHTELGGSGQHLLQRLPQLIL
FT                   SLITEAQARVASGAHQRRRRIRSFVGKPVQHRAAAPAQVLITTCAEPARRDPKPVGPGQ
FT                   VPGQPLRRSALGNQLPLRLQVALDRQSNRQHRLAVRVRLLEHGAVLRPEAAQVQAIRLK
FT                   VLERVVELAHGNLDHDGLVDIHAEKIMVAELRGAPRAQAQIDGVKNARLARVTRSDQRV
FT                   EARARPPGEMLDAAKVADLDFAQASH"
FT   gene            147474..149189
FT                   /locus_tag="PHG151"
FT   CDS_pept        147474..149189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG151"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Bradyrhizobium japonicum gi:27379743"
FT                   /db_xref="EnsemblGenomes-Gn:PHG151"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85903"
FT                   /db_xref="GOA:Q7WXI3"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXI3"
FT                   /protein_id="AAP85903.1"
FT                   /translation="MTRLRKIEIRHFRGIQHFTWWPGPGLNALIGPGDAGKSSILDAID
FT                   LCLGARRTAQFGDHDFFRMNVDQPIVIEITVGELDDALKNFEAYGLYLRGFRAEDGAVL
FT                   EEPDAHCETVLTIRLTVQSDLEPQWQLISERAAAQGLTRHLAWADRLRIAPGWLGASGD
FT                   QNLSWRRGSVLNRLSDERADASAALVRAGRDARLRFGDEAQNQLGQALQQVLATATELG
FT                   VPVGGEVKALLDAHAISVTGGAIALHDAAGVPLRSLGLGSGRLLVAGLQRAAAMETSVV
FT                   LVDEIETGLEPHRIYRLLVTLGAKEPAPPLQVFLTTHSPVVVRELSGAQLYVLRQRDGV
FT                   HVAHCCGTSDDVQGTMRRHPEALLGKSVMVCEGASEVGLVRGLDQYWSGSPSISTFGVV
FT                   LVDGSGSSAVQRAMAFQALGYRVALLRDSDVPPKVDEVSFKAAGGEVFAWRQPNALEDE
FT                   LFQSLAIESVTQLWQLAKEKKGEDLVDAHLRSASGNKLTLPEIEKQLYVDRVITNEARL
FT                   ALGQASRNSKNPWFKSVTAMEEVGFTIVGPGFESAEPAFGTEVAKLFQWCHHHG"
FT   gene            149278..150600
FT                   /locus_tag="PHG152"
FT   CDS_pept        149278..150600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG152"
FT                   /product="conserved hypothetical protein"
FT                   /note="helicase-like; Pfam entry PF00580; similar to
FT                   Micrococcus sp. 28 gi:18025395"
FT                   /db_xref="EnsemblGenomes-Gn:PHG152"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85904"
FT                   /db_xref="GOA:Q7WXI2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXI2"
FT                   /protein_id="AAP85904.1"
FT                   /translation="MRHGQSKPILLLTHTNAGVAALRKRLEHARVDPSRYRLGTVDGWA
FT                   MKLVATFPARAGIDPALLAALRPDYNAIREAAARLLAGGHVGDVLASSYARLWVDEYQD
FT                   CSVRQHAIIQAASAFLPTCVVGDPLQAIFGFGGDPLASWQDDVCRHFPRLFTLDRPWRW
FT                   INAGAEVLGQWLLQARQVLLNRQPINLASAPPAVQWVQLDGSAGDHARLLQAAGTAAPH
FT                   RDGTVLVIGDSTSPQSQQRMASLVPGAVTVEAVDLRDLVDFATGLQLAAPEALRRVVEF
FT                   CGRLMTGVGVAALLERVEILRRGTARREPSLAEAAALAFEAERSLPAVKRLIEAVRQQP
FT                   GTRVFRPIVLRACLTALDTSSTGGTTLQEAAIRIREQGRMQARALPRRAVGSTLLLKGL
FT                   EAHVAVVLAADTLNASNLYVALTRGSTQLVVCSRTPQLLGR"
FT   gene            151891..152160
FT                   /locus_tag="PHG153"
FT   CDS_pept        151891..152160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG153"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85905"
FT                   /db_xref="GOA:Q7WXI1"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXI1"
FT                   /protein_id="AAP85905.1"
FT                   /translation="MSWDGQGEMPDWLRRAVNAGQSVEFFLGRELQPALQLKESDFWLR
FT                   PLPRNGDTICWENEESHHYIWYKCEMCGLCLGLTLSADFTRVPP"
FT   gene            complement(154253..154423)
FT                   /locus_tag="PHG154"
FT   CDS_pept        complement(154253..154423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG154"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXI0"
FT                   /protein_id="AAP85906.1"
FT                   /translation="MDESYAEDGYVEPGYFEQEVYVLLVEDNGLTLSGKIEVVELAHRV
FT                   LDFWRTKLTTS"
FT   gene            156058..156237
FT                   /locus_tag="PHG155"
FT   CDS_pept        156058..156237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG155"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85907"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXH9"
FT                   /protein_id="AAP85907.1"
FT                   /translation="MAEARQSHGAVQADLAAERQAHAATQARLEAGRTELEAGRRQLET
FT                   LRTQFSTELEPASR"
FT   gene            156234..156782
FT                   /gene="kfrA2"
FT                   /locus_tag="PHG156"
FT   CDS_pept        156234..156782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kfrA2"
FT                   /locus_tag="PHG156"
FT                   /product="putative KfrA-like protein"
FT                   /note="similar to Deinococcus radiodurans gi:15806559"
FT                   /db_xref="EnsemblGenomes-Gn:PHG156"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85908"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXH8"
FT                   /protein_id="AAP85908.1"
FT                   /translation="MTLAQERAEASERRSLRELDAERTARQQSERAAEALRGELAAVRS
FT                   EARDVAVAQAEIRARLEAQAAALADRLATAEQAQRKAAHDLDALQAELGAAQRRAERAE
FT                   AEAALARQLLAELRVAPAGRGEGGGGRRRKAGDPAPTEQAAPGEKQNEQQDDKQGAPAA
FT                   ALNPEDGSDSSDDSNDSKN"
FT   gene            156766..157029
FT                   /locus_tag="PHG157"
FT   CDS_pept        156766..157029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG157"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia solanacearum gi:17549254"
FT                   /db_xref="EnsemblGenomes-Gn:PHG157"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85909"
FT                   /db_xref="GOA:Q7WXH7"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXH7"
FT                   /protein_id="AAP85909.1"
FT                   /translation="MTAKTERAAAIRWIRAEMADYGLTMEELAAAGCFDPPPPPPPPPP
FT                   APAPVVCYRNAAGQSWDGQGDMPDWLRRAVNAGQAVEFFRVG"
FT   repeat_region   157256..157263
FT                   /rpt_type=DIRECT
FT                   /note="target site duplication"
FT   mobile_element  157264..159724
FT                   /mobile_element_type="insertion sequence:IS883"
FT                   /note="member of the IS66 family"
FT   repeat_region   157264..157285
FT                   /rpt_type=INVERTED
FT                   /note="IS883 terminal IR"
FT   gene            157424..157744
FT                   /gene="tnpA"
FT                   /locus_tag="PHG158"
FT                   /note="putative transposition-related protein"
FT   CDS_pept        157424..157744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PHG158"
FT                   /product="putative transposition-related protein"
FT                   /note="similar to Shigella flexneri 2a gi:15808733"
FT                   /db_xref="EnsemblGenomes-Gn:PHG158"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85910"
FT                   /db_xref="GOA:Q7WXH6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXH6"
FT                   /protein_id="AAP85910.1"
FT                   /translation="MAAAACEPGVSVSKLAREHGINANMLFTWRRRYRMEQRQEAAVLL
FT                   PVTVEHPSSPPGPMPMSPAAAVCEPTPPHGAIEIRLGRAVIRIEGAVDATTLRTVLDRL
FT                   TP"
FT   gene            157741..158088
FT                   /gene="tnpB"
FT                   /locus_tag="PHG159"
FT   CDS_pept        157741..158088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpB"
FT                   /locus_tag="PHG159"
FT                   /product="putative transposition-related protein"
FT                   /note="similar to Shigella flexneri 2a str. 301
FT                   gi:24111814"
FT                   /db_xref="EnsemblGenomes-Gn:PHG159"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85911"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXH5"
FT                   /protein_id="AAP85911.1"
FT                   /translation="MIGLPAGTRIWIAAGVTDMRCGFNGLAAKVEATLQESPFSGHVFV
FT                   FRGRRGNVIKVLWSTGDGLCLLSKRLERGRFVWPQADSGKIHLTQAQLSMLLEGINWKQ
FT                   PERTWPPLSVL"
FT   gene            158119..159672
FT                   /gene="tnpC"
FT                   /locus_tag="PHG160"
FT   CDS_pept        158119..159672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpC"
FT                   /locus_tag="PHG160"
FT                   /product="putative transposase protein"
FT                   /note="Pfam entry PF03050; similar to Escherichia coli
FT                   gi:14252930"
FT                   /db_xref="EnsemblGenomes-Gn:PHG160"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85912"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXH4"
FT                   /protein_id="AAP85912.1"
FT                   /translation="MPIDPSDLPDDIEALKALVLAQRESIALMERALAVRSMEIEQLNL
FT                   QISKLRRMQFGQKSEKLDRQIEQLETRLEDLLAEEGAAETEADPQATPPVRKKAVRKPL
FT                   PEHLEREERILEPETEACPECGGKLKPLGEDISEQLDIISSSFRVIRQVRRKKACACCD
FT                   CIVQAAAPSRPIERGIATAGLHAHILVAKYADHQPLYRQAAIYARQGVELDRTTMARGV
FT                   GACGALVRPLVEALHRYVMMPGKVHADDTPLPVLAPGKGQTKTGRLWAYVRDDRASGSD
FT                   AAPAVWFAYTPNRQGQHPQAHLAGFRGILQADAYAGFNAVFTDGSVREAACMAHARRKV
FT                   HDLHVRKATPTTTEALRRIGELYAIEAEIRGKPPAVRQQVRQQRSRPLLDSLEVWLRER
FT                   LLTLSTQSETTKAINYMLNQWQALIYYCDDGLAEIDNNIAENALRGVALGRKNFLFAGA
FT                   DSGGERAAAMYSLIGSCKLNGIDPEAYLRHVLARIADHPVNRIDGLLPWNVAAQLALQA
FT                   "
FT   repeat_region   159703..159724
FT                   /rpt_type=INVERTED
FT                   /note="IS883 terminal IR"
FT   repeat_region   159725..159733
FT                   /rpt_type=DIRECT
FT                   /note="target site duplication"
FT   gene            159765..160955
FT                   /locus_tag="PHG161"
FT   CDS_pept        159765..160955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG161"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85913"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXH3"
FT                   /protein_id="AAP85913.1"
FT                   /translation="MRLGLTSTTYALPSRDLVDWECVEDYRAHREAQENARKDAERDRL
FT                   RAAVTAELRWLSGEGDEPGWPELPDPRSPKVRAGIPLGVPRRQRAKPPAPREYALDSSA
FT                   AAHWLSLAKDLWYRDAPERLRGLVLHCWAWTASANGVGCKKDEEPGERAHQWNEAYFAA
FT                   ATAAAATLGDAGLSEMVLQRVAQLPQDRFLDATTAVLHELDRLWMNNGLVSGPLVLLVW
FT                   ETLASRIREFWAWKRLTSECSTSAEIHLTGALAALFMGEYEIGKGPRCYVRPPGAEGAD
FT                   ALLPMLTRLAVEAAPSTFVALAILGLLEVQPQVHRLTFLAGVVSAWWRAQGANTEFWND
FT                   YGIGPRVCAWVEKAILSAPVPQEVLDSAELTSVVDTLVQTGTPLARILDEKLARPR"
FT   gene            160981..161127
FT                   /locus_tag="PHG162"
FT   CDS_pept        160981..161127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG162"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85914"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXH2"
FT                   /protein_id="AAP85914.1"
FT                   /translation="MAHLGLTYEQHLLAAGCFASPGVAGGKKVSVERLSEEFRDSPPNR
FT                   GEA"
FT   gene            166940..168394
FT                   /locus_tag="PHG163"
FT   CDS_pept        166940..168394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG163"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Streptomyces coelicolor a3(2)
FT                   gi:21234012"
FT                   /db_xref="EnsemblGenomes-Gn:PHG163"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85915"
FT                   /db_xref="InterPro:IPR041427"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXH1"
FT                   /protein_id="AAP85915.1"
FT                   /translation="MQGLPVSPSLIPLDTLREQIARAVATAKAYDVPDVCVGLRIQQSV
FT                   DEADAQEAFGSKRLYVRRRIISWSEADLLDLATRVLRDYPSEELADIVSEMTVHAEQRV
FT                   SALVRRDVLKALNPLASLFGDLPLIDGLRVVFGASVIQDDPTGLTGLLGLTSLHGQIVQ
FT                   HCLRNDDWSHEELLIQCGAMTCSQTRFFSLLNKLLHPMSRRDGEQATLATAIDTALRRD
FT                   GFAVRKTSVESGYAVYGVVRMQAGVVGAMKNLIFASIGEKPELVFRDAVNNDVEIIKHA
FT                   DKVLVFDRPLPNSGLLLWKDLRDWYAELQGISDVASAKENLFRRLRQAVLGARSAGEFA
FT                   VFQGYYERYGGPLGERLPALVPQVYLHYDPYTRRQRGDEQFLARQRMDFLLMLDHGVRI
FT                   VIEIDGRHHYAVPDPLAPDRFIANSQRYAEMVAEDRRLRLMGYEVYRFGGYEFLDVDLE
FT                   QRRVGPHAQKCVADFFDRLLARHCVR"
FT   gene            complement(169034..174850)
FT                   /locus_tag="PHG164"
FT   CDS_pept        complement(169034..174850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG164"
FT                   /product="hypothetical protein"
FT                   /note="SMART domain SM00020; serine protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:PHG164"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85916"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXH0"
FT                   /protein_id="AAP85916.1"
FT                   /translation="MTEEEVKLATCQVLGAGEAGTGWLISADHVLTAYHCLGEAADQGV
FT                   SLEVSFGVGQSASKQQAVLDAFDTDLDVCILRLQEPSAFAPVALNVGAPRPGERWLSFG
FT                   YPVSKLQIGQVLQGAVQQALNELANGVDLDLSVSPETVLTDYRGMSGAALMTTDGCQGM
FT                   LRVSVDNALGAVSTEALREFLAANGLLPEGEASQGDASPFASRPAFDELFESTVVKAGG
FT                   GYLFLDGAHGIGKSTYCRGFKPESANVEVLGVYAFSECSRGSTPALQVQPEVFVDWLTS
FT                   LLSTRATGKPARLMQLTYAQLIQTTHQAFQALAQRCSSDGKVGVLFIDGINEAAAVGGD
FT                   ALQRFVGLLPPSIPPGVQVVVVGAGLDAIAGKLSPLLYGAERLTLPTLDEDIQYRLCAS
FT                   SLDAEKVTSTLVSALCERAKGHPLYLRYLVDLVNGGASEGDLESLPPFSGSIEDYYESI
FT                   WAQLLAETDAINLLSIVTRLRWGIPTTDLMAMLTPSESAAFVPTITRIRHLLSAPDTTE
FT                   VYHSSFSDFVVHKTSTQSEWVQGRLAEFCLQPGSGDYGTLNRVFHGLRADAQKQLAAIG
FT                   ECQQQWVDQSVLLGAEPDVLLGDIEDSLEAATRLGTATDIFRLLLLSQRLKFRYDTLFA
FT                   QSAGLAAEALIALGKTEQAMRHILRYGHLIVDPSDAFAIARSLIEAGHQNEALEILQKV
FT                   DSLLLPILTRDGVKVGEYLNAAAVKLQGYGLASYAGADPSTFDFLKYVIRLVKAPQNNI
FT                   SQEHGQKLLSDVIGNMLGNILCVAHSYKPLSQLPIPTDTPNKDQALSLISVLAYARIHA
FT                   RNYGTRLPRDKVEMLLADIGSKIDDSLTVDEKAFGVVDLLIEAGADAGLVEAYSNGVVW
FT                   DAATLPLFTENRSLADEKAFVEAYARLRAANFLGRNQTRPMPEALEHGNWEEWLETLAQ
FT                   AVAWADAKVRHARATSDPAALASAKKYLNDEVLPFFRLELASRMLWAGAYFIPENILPL
FT                   LYGHLADLYLDCLPDEAAELLEVIQESFDGQLGLYNEGFRRALAAVIGTLVNAGISGDT
FT                   ADKAFALLLRWRDYVRDNVQNRHELVPELLSMVPLFARMESAEEALRTYHSVLAASMGP
FT                   SWYKEDQFAVMSRVLEALPADAEIAPAALAQIAAYLEHASGEMTFQRYVRSDKGTFIGE
FT                   LSRRGMYADAVRYFQHQAHGSIKEMCEQASDGGLDRVAPLVGMRYPGGALEEQAALMQL
FT                   LEHAGIHADWRVRWALLEVYQHGDERYLRDWGPAYATIIQEISHSAADLAWAVKRIGRI
FT                   AHTMNAERAWMLMHSLTGALPAFLCEAFSEMLQQFRESFSPNQFDQLTARFGVRSEVVA
FT                   GGPPNPDVPNAAEAAETDEEDGGEDRLFMPGTFGSRTSVRDADLALEEARKHIKRRNTS
FT                   AAVERAVFALRALQGGGWSIWEKGHSGSSLADTIIRENVQSADELARLYGPLALNEQHV
FT                   QRWTAAYHLINLIGPKLDASQRTQLLSVATEHVREMVGSAPSEAFSYIGATKPVSASDA
FT                   LLELLLWALDHPSWERRDTAAAMVLWLLRSDDALMARLARLAFSMDSGSRADVAAGALD
FT                   ILSRETPASLWERVVRFVDVNEVVRACTHAGRFATLLRIADRASNKGVASAADAVKVLR
FT                   AKPIAHPSPEDPAKSRLHADHVPPSLTASWRELTRLGILNDAALQRAASILQDSCGPYA
FT                   LSDVQQLDSLAARRHGEWAGVVPDRWAARVRFALNVALFAPASIEQLAKIEAALRIYNP
FT                   ESLVEPPDGRRLVAGLIDAMESGNETRFLPSSDDLVFLDVQCYLERRRQVIKVDLTSHL
FT                   LPPGQREPNSGQLGTFKPTELPRPGPSDQLTVCGRVKPGLAHFGALTPAIANPQFVDLL
FT                   RAPPSAMVRYHWRDGSTVRTRGVSRRHEVSILAIRRDALTLPAGWRMQWMLRINGQVRA
FT                   VLHKA"
FT   gene            complement(174862..175380)
FT                   /locus_tag="PHG165"
FT   CDS_pept        complement(174862..175380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG165"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam entry PF00753; similar to Yersinia
FT                   enterocolitica gi:05420075; metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PHG165"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85917"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXG9"
FT                   /protein_id="AAP85917.1"
FT                   /translation="MVCAYTRQPAPAMVKTISAGSTKRLNEVYVPDISPTNGSSIATLI
FT                   ESEGKRLLFLGDAWAEDVVVELKRLHGDGRPQLFDAIKVSHHGSIHNTSVDLLSLIDAP
FT                   IFLVSTNGSIHHHPDYEVLAEIVDRPATFERKIYFNYETPASTRLRAHVSRSGAKFNVD
FT                   VVQDGWIHV"
FT   gene            complement(176174..176485)
FT                   /locus_tag="PHG166"
FT   CDS_pept        complement(176174..176485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG166"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Xanthomonas campestris pv. campestris
FT                   str. atcc 33 gi:21231075"
FT                   /db_xref="EnsemblGenomes-Gn:PHG166"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85918"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXG8"
FT                   /protein_id="AAP85918.1"
FT                   /translation="MRKVPEIKKSDLNYEDYSWTTVTGDDPKKTKEDADRFSRKEGYEV
FT                   LTLLNSLKGKDQADLSIRTRQICEWMIHEKLPSDIQGRSKVINWIAANYSDLKEKYPF"
FT   gene            complement(176708..178609)
FT                   /gene="uvrD"
FT                   /locus_tag="PHG167"
FT   CDS_pept        complement(176708..178609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="PHG167"
FT                   /product="putative helicase, superfamily I"
FT                   /function="DNA unwinding"
FT                   /note="Pfam entry PF00580; similar to Pseudomonas putida
FT                   kt2440 gi:26990390"
FT                   /db_xref="EnsemblGenomes-Gn:PHG167"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85919"
FT                   /db_xref="GOA:Q7WXG7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXG7"
FT                   /protein_id="AAP85919.1"
FT                   /translation="MSLPPRRVPPGDWQPVGVHSLEPNALTVVRSAEHRSVLAGPGAGK
FT                   TELLAQRAAFLLQTGASPAPQRILAISFKRDAARNLARRVRQRCHPDHASRFDSLTFDA
FT                   FAKSLVDRFGQALPNRWRPTADYGILFPKRAHWADFLQRASLALDNPFGQAAVQGLSVN
FT                   YFERRHVLAERLPEAGWTSGNAGLWAGQRFWDEQLRGATRSHLTFPMLSRLAELLVRVN
FT                   ASVRNALALTYSHVFMDEFQDTTEAQFDLVQTIFLGMPTILTAVGDNKQQIMRFALAMD
FT                   DPFGAFEQTFGAQRIPLLSNYRSSPELVRIQHVLAQALDTSAAHPQSKAAASISDACCA
FT                   IWDFSSVNTEAQALARYVASQMREHQLQPNDFVLLVRQKAEDYARVLAPAFATAGIPLR
FT                   NEAAYVGAQMLQELLTEPLSELVLLILRLACAPRGGLTWIEAQHALANLRGIAPTDDRA
FT                   RRVLAQDLDAFARRFIQQHPQPPETEAMARAVIQEVEAFLGRDALIAAHTPYGQGGWLA
FT                   EVENSLALHLQSSAVQATDWAATLDAYEGTKALPLMTLHKSKGLEYHTVIFIGLDDSAW
FT                   WSFVQDTVDATAGFFVAFTRAKQRVIFTYTPQRGARVNIAPLYGLLATAGVQTITVA"
FT   gene            complement(178612..180582)
FT                   /locus_tag="PHG168"
FT   CDS_pept        complement(178612..180582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG168"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam entry PF02463; similar to Microbulbifer
FT                   degradans 2-40 gi:23027981"
FT                   /db_xref="EnsemblGenomes-Gn:PHG168"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85920"
FT                   /db_xref="GOA:Q7WXG6"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXG6"
FT                   /protein_id="AAP85920.1"
FT                   /translation="MHIESVTIAGFRCFGPNPTAIPFSQGLTAIVGPNASGKTAVLQAL
FT                   MRLFGVTRAQRTIVPSDFHVTPTETERLKSRTLTIDVRLSLPELVDGSATAATVAPVFR
FT                   HVRIERPGGTPLCRLRLRARWDDDGTAEGAVSQDLNWINTADDVVRDDQASPVAPGDRG
FT                   LIQLFYTPASRDAGTQIRATTGALAARLLRAIEWSAGTQATVHAATEQLLNAFGSENAI
FT                   QAISESLSKRWEKLHDGDIDCNPELSLMSRRFEEVVARIGVMFKRGPAGEDRGLDALSD
FT                   GQQSLFYFALAAAVFDVERAAVAGRIQGFRTEELNVPALTLFAVEEPENHLAPYYLSRI
FT                   LQQIRTLVETGAGQAIVSSHSPSVLGRVPPDDVRYCRRNQATGVSTVLPIPMPTSDVEA
FT                   IKFVRNAFLAFPELYFARFVLLVEGDSERIVLPRLAEALNLLVDPSFVAIVPLGGRHVN
FT                   HFWRLLHGLGIPYATLLDLDLGRDGGGYGRLKNALQQMLALGVPREKILELSDGTHLSD
FT                   KRLAEMETFDAANLEGWLSYLERSSSVFFSWPLDLDLAMLAAFPAAYAATIDGAGPRMT
FT                   NESAAEVVLGTAGPGLISYTGNAQMFRDHMAAYRYHFLTHSKPATHLRALTHIDLPALK
FT                   AGMPAPLQRVLLHISAQVSRL"
FT   gene            complement(182768..183343)
FT                   /locus_tag="PHG169"
FT   CDS_pept        complement(182768..183343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG169"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Vibrio vulnificus cmcp6 gi:27367741"
FT                   /db_xref="EnsemblGenomes-Gn:PHG169"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85921"
FT                   /db_xref="GOA:Q7WXG5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXG5"
FT                   /protein_id="AAP85921.1"
FT                   /translation="MKKAGQVKTWHADKGFGFIDVYADMKDVFFHVTALQTRAVTPTPG
FT                   DRVSFELGKGKDGRIQALNVAIVGAPKSRSDASPLPVLAGLAALGFIVGGALVGYFPRQ
FT                   AGIVSLLASIITFSAYADDKTRASRNTWRTPETTLHLLALCGGWPGALAAQHLLRHKNR
FT                   KREFQVSFWGTVAVNVGAMALWQYVIAA"
FT   gene            183573..184517
FT                   /gene="mrr"
FT                   /locus_tag="PHG170"
FT   CDS_pept        183573..184517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrr"
FT                   /locus_tag="PHG170"
FT                   /product="putative endonuclease"
FT                   /function="restriction of foreign DNA"
FT                   /note="SMART domain SM00399; similar to Deinococcus
FT                   radiodurans gi:15805614"
FT                   /db_xref="EnsemblGenomes-Gn:PHG170"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85922"
FT                   /db_xref="GOA:Q7WXG4"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXG4"
FT                   /protein_id="AAP85922.1"
FT                   /translation="MGRRRKEPSLSEILMDAPWWVSAALALGAFIVFRGVVPGIFASSP
FT                   LLTGIAVLSQSLAWVPAAMFGFLGVLSYIRARGRAGARQQEIPMRARRSRTSRPSSAPV
FT                   SPRYSDESAESKEAVSPLARTASVPEKPEINSWTLDALKLLEWKRFELLCVGYYEAMGF
FT                   VVKTVPHGPDGGIDATLYKAGLDVPVAVVQCKAWSKPVKVEQVRALAGVMHEHKVRRGV
FT                   FWSLSGYVGRPVKESAERAGIQLLDGAGILERICALDQYKQATLLKQAFRGDYRTPTCA
FT                   ACGIKMVERQGSAGAFWGCQNYPGCKVRLSRNV"
FT   gene            186521..186790
FT                   /locus_tag="PHG171"
FT   CDS_pept        186521..186790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG171"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85923"
FT                   /db_xref="GOA:Q7WXG3"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXG3"
FT                   /protein_id="AAP85923.1"
FT                   /translation="MISADLGQQLERYVTELVASGRYGSKSEVLREGVRLIQDREAQLM
FT                   ALDAALAQSLAEADAGRGTDAATVFDRLEAKYRAAAGRTPGHGA"
FT   gene            186787..187092
FT                   /locus_tag="PHG172"
FT   CDS_pept        186787..187092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG172"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Mesorhizobium loti gi:13488359"
FT                   /db_xref="EnsemblGenomes-Gn:PHG172"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85924"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXG2"
FT                   /protein_id="AAP85924.1"
FT                   /translation="MIVVRLTPLAEAELEAIADYIARDNPRRALSFVRELRDRCLSLAD
FT                   MPLAFPLVPRCEDRGVRHRVHGNYQIFYRVVGDPPARIDVLHVLHSARNYAALLFN"
FT   gene            complement(187329..187577)
FT                   /locus_tag="PHG173"
FT   CDS_pept        complement(187329..187577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG173"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85925"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXG1"
FT                   /protein_id="AAP85925.1"
FT                   /translation="MSMPKTIEPLPKGRYWATPHASFPLDGPNGHDEVFPGAHCVSDGK
FT                   WVIFYKDGEEVWACNAIYAAAHFDFAAVSSACASTAD"
FT   gene            complement(188352..188780)
FT                   /locus_tag="PHG174"
FT   CDS_pept        complement(188352..188780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG174"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85926"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXG0"
FT                   /protein_id="AAP85926.1"
FT                   /translation="MVAVKHDDLSMAFDFVSCAAPMEHNAYVSLDTGKVYWTSDYNDTF
FT                   DEEVPDDLETSDRYLAIPHKNELGLGRSLALQFVAQELPECRDQVEEFFRRQGAYARLK
FT                   DLLERKGILELWYSFEADSAERALRQWCAESGLEILES"
FT   gene            complement(189016..189939)
FT                   /locus_tag="PHG175"
FT   CDS_pept        complement(189016..189939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG175"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Methanosarcina mazei goe1 gi:21227582"
FT                   /db_xref="EnsemblGenomes-Gn:PHG175"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85927"
FT                   /db_xref="GOA:Q7WXF9"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXF9"
FT                   /protein_id="AAP85927.1"
FT                   /translation="MLSPIASYRGAIAKTFWGKAWCDNLESYSDYANRLPRGRTYVRNG
FT                   SVIDLQITAGEVRAQVMGSSLYTVAVTVTACPAKQWRAIGADCAESIDSIVELLQGKLS
FT                   TAVMERICKPRSGLFPMPEDIRFSCSCPDWASMCKHVAAVLYGIGARLDQQPELLFALR
FT                   RVDANDLVRQAGAGLPKSTKRPATSKVLDDALVADVFGIEMADANPPPKPAVRLNKPPA
FT                   GKVTAKKATKSAVSTTRKPPANAKTAEDNKSVTKKSSVKASAGPRKSASGNVVAGKANV
FT                   ATPPATQNEAATRKRVSTRPVKGTSR"
FT   gene            complement(190057..192735)
FT                   /gene="helZ2"
FT                   /locus_tag="PHG176"
FT   CDS_pept        complement(190057..192735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="helZ2"
FT                   /locus_tag="PHG176"
FT                   /product="putative helicase, superfamily II"
FT                   /function="DNA unwinding"
FT                   /note="similar to Mycobacterium tuberculosis h37rv
FT                   gi:15609238"
FT                   /db_xref="EnsemblGenomes-Gn:PHG176"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85928"
FT                   /db_xref="GOA:Q7WXF8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022138"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXF8"
FT                   /protein_id="AAP85928.1"
FT                   /translation="MTAPDILVPHLTPGGHLLAVPEDAAPILADETRQRLESSFALGAG
FT                   HGLLHLGTAEIGRILPPAWAWWRDFAARYVTALCATPEGGEIAVATPAAKDFDAMIDDA
FT                   PPMTGGEYLTPAVLGTLWGEIDTALHQELATANVSLQDFLKLRHPAWNLVGRVHFNLAE
FT                   NRKDPESPFAFLATYTSRLSAHGKAQHQPLSQALAEFSGVRSKAQLLSLLLPVQRAAEH
FT                   CDWLREMVDTGEIYHPLRWTPLDAHRLLSDLSKLEAAGIVVRMPGVWQAGRPARPVVKA
FT                   SVGARPPSLLGKDALLDFSMEVSLDGECLSATEVRNLLKGADGLQLIRGRWVEVDKKKL
FT                   SRLMKRFEAMEKAARSGLPLNEALRLLAGVSLDDSADPADRDWSQLVAGPWLADTLQEL
FT                   RQPEGLAQISPGPELKATLRPYQQAGVRWLYLLTRLGLGACLADDMGLGKTMQVLSLLL
FT                   VLKRESAEARPSLLVAPASLLANWAAEAERFAPGLRLLIAHPSAMPTAELRALDPARLA
FT                   DIDLVITSFGALLRQPVLGAFQWRVAIVDEAQAIKNPGAKQTRQVKQLQAQSRIALTGT
FT                   PVENRLSDLWSIFDFTHPGLLGSDKVFADFTRRLAKAEHFGPLRTLVRPYILRRLKTDK
FT                   RIIDDLPDKTELKAWCHLSPSQAALYQRAVKDLAAALEDADGIGRKGVVLSYLMRFKQI
FT                   CNHPSQWLGDAAWKAEDSGKFARLRQLAEVIAAKQEKVLVFTQFRETTEPLAAFLGSIF
FT                   GREGLVLHGGTPVAKRRELVKRFQEDELTPFFVLSLKAGGAGLNLTAASHVIHYDRWWN
FT                   PAVENQATDRAFRIGQRRNVLVHKFICRGTVEDRIDQLIEAKQQLVKDVLEGGAELLLT
FT                   EMSNRELLDLVKLDVHAAQEN"
FT   gene            193385..193843
FT                   /locus_tag="PHG177"
FT   CDS_pept        193385..193843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG177"
FT                   /product="putative histone-like protein"
FT                   /function="DNA condensation"
FT                   /note="similar to Burkholderia fungorum gi:22984663"
FT                   /db_xref="EnsemblGenomes-Gn:PHG177"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85929"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXF7"
FT                   /protein_id="AAP85929.1"
FT                   /translation="MVAATKATKVSAVSKNKSAAKKVAVPTKKASVLAREAQAAKKRLL
FT                   KLRADMKKAIEAAKREVAQAVEAARSALRFEKQAAKDKLAAKKAKAADAKKAAGKVAAT
FT                   KAAPKKAVTGTKASVKAAPKKAAVKAVTKKRTPAKAVVPTVATPEVSA"
FT   gene            complement(194535..195272)
FT                   /gene="phaZ"
FT                   /locus_tag="PHG178"
FT   CDS_pept        complement(194535..195272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaZ"
FT                   /locus_tag="PHG178"
FT                   /product="putative PHB depolymerase"
FT                   /function="PHB utilization"
FT                   /note="similar to Ralstonia eutropha gi:03641686"
FT                   /db_xref="EnsemblGenomes-Gn:PHG178"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85930"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXF6"
FT                   /protein_id="AAP85930.1"
FT                   /translation="MLRDVVQSLLQEHIVYVTDWSNGAIALLASRDEATPTSLTLIGGP
FT                   IDARRSPTAIGRLASSRSIQWFRRNLVYPVPHPYAGAGRQVCPSFVQLSGLAAAQSSPL
FT                   WGLCEGYWANLARGDAERANVHWQALLDYSAVLDMAAEFYLDTVRTVFQEFQIAFGTWR
FT                   VRGQLVRPQDIRSTALLTIEGELDDISGRGQTHAAHDLCRGLSAHDRRLVTIAGCTHYD
FT                   LFRGPVWHTEVFPWICDMTRDDM"
FT   gene            complement(195857..196054)
FT                   /locus_tag="PHG179"
FT   CDS_pept        complement(195857..196054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG179"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85931"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXF5"
FT                   /protein_id="AAP85931.1"
FT                   /translation="MLSPHEIAALLLLGDAPDVHDVDPDRLDALLEQKLVTMEHGHDSG
FT                   AHPRLTSRGHSLLDAVRRIR"
FT   gene            196965..197276
FT                   /locus_tag="PHG180"
FT   CDS_pept        196965..197276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG180"
FT                   /product="H-NS-like protein"
FT                   /note="similar to Ralstonia solanacearum gi:17548556"
FT                   /db_xref="EnsemblGenomes-Gn:PHG180"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85932"
FT                   /db_xref="GOA:Q7WXF4"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXF4"
FT                   /protein_id="AAP85932.1"
FT                   /translation="MATYKELMAQKAALEAHLEEARANEVASVIEQIQNLMAEYGLTVE
FT                   DVTKRRRGRPAGSGAGKAKAGLPPKYQDPKTGKTWSGRGRAPSWLGKNPNKFLIAEEA"
FT   gene            200355..201065
FT                   /locus_tag="PHG181"
FT   CDS_pept        200355..201065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG181"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Haemophilus somnus 129pt gi:23467771"
FT                   /db_xref="EnsemblGenomes-Gn:PHG181"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85933"
FT                   /db_xref="GOA:Q7WXF3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR017056"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXF3"
FT                   /protein_id="AAP85933.1"
FT                   /translation="MSEGHVFICGDPHGEFGPLIESVHRHRPEAVVLAGDIQARRPLDE
FT                   ELASILPLTQVWWIPGNHDTDSDADYDNLFGSALADRNLDGRVVTIAGLRIAGLGGIFR
FT                   GQVWMPPEPARMESESDYLAKCGKGNYWRGGLPRRHRSTIFPQTYNALLSQHADVLVSH
FT                   EAPACHPHGFEAIDMLIEAMRVKRAFHGHHHESTAYPTAGPCRIFGLGACAVATIEGEF
FT                   LPSVLTCPDQVEGG"
FT   gene            complement(201720..202415)
FT                   /locus_tag="PHG182"
FT   CDS_pept        complement(201720..202415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG182"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Helicobacter pylori 26695 gi:15645609"
FT                   /db_xref="EnsemblGenomes-Gn:PHG182"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85934"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXF2"
FT                   /protein_id="AAP85934.1"
FT                   /translation="MKVELKGDIWESLFPHAFTLMEEVRKHGGIEPFWTFGGGTVLMLR
FT                   YRHRFSRDIDLFVPDPQCLGFVSPRLSEAAESITSDYVEQGDFVKLVLDAGEIDVVASP
FT                   NLTDKPFEIWEIMGQSVKVETAAEIVAKKLYHRGDRATARDLFDLAVVVEHEPTAHTHA
FT                   APFLLRHASAFRGQVEAGPPIMREQFDRIQRINFNRCFDECVALVGDFLHSLQETDDTA
FT                   QKSRERQRP"
FT   gene            complement(202412..202915)
FT                   /locus_tag="PHG183"
FT   CDS_pept        complement(202412..202915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG183"
FT                   /product="putative regulatory protein"
FT                   /note="SMART:HTH_XRE; XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:PHG183"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85935"
FT                   /db_xref="GOA:Q7WXF1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXF1"
FT                   /protein_id="AAP85935.1"
FT                   /translation="MNPALLGNAIQRKRVALGLTQQQLADMAGLSRQSLNGIEHGSVNA
FT                   TLQSLGRLMDVLGLALDINDPDERRLASGSPMRALWMAAKGANVSYTGELTPDELERAL
FT                   ATGEVPSEYRPQVAHVLDEAPLQLVTKVVAEVAAKQHRNPADIWKNLRRLAQTLMVTRG
FT                   GLWA"
FT   gene            complement(203182..203478)
FT                   /gene="dinJ"
FT                   /locus_tag="PHG184"
FT   CDS_pept        complement(203182..203478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinJ"
FT                   /locus_tag="PHG184"
FT                   /product="DNA-damage-inducible protein"
FT                   /function="DNA repair"
FT                   /note="similar to Sinorhizobium meliloti gi:16262700"
FT                   /db_xref="EnsemblGenomes-Gn:PHG184"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85936"
FT                   /db_xref="GOA:Q7WXF0"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXF0"
FT                   /protein_id="AAP85936.1"
FT                   /translation="MAHTSMLHIRVDDDLKARATQNLARVGLTVSDAVRILLTRIAKEG
FT                   GLPPGLTTSPETYDAWFRAKVQQALTDPAPPPPHDQIMDDAQALIDRKRRARG"
FT   gene            203989..204915
FT                   /locus_tag="PHG185"
FT   CDS_pept        203989..204915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG185"
FT                   /product="putative regulatory protein"
FT                   /note="similar to Pseudomonas syringae pv. syringae b728a
FT                   gi:23470717; histidine protein kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:PHG185"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85937"
FT                   /db_xref="GOA:Q7WXE9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXE9"
FT                   /protein_id="AAP85937.1"
FT                   /translation="MPGAPDTAAQIHAVIRARGGFNINQLVAEYRALRASVLRLWMDEF
FT                   ELVAGDLDDVMRFNEAIDQAVAESVDFFNAEVEQSHNLLLGMLGHDLRSPLQTIQMTAS
FT                   YLAALNAGEKVSEAAARLIRSGASMNSLLDDLCDFNRTKLSLGINIAPIEVGLAHVVGD
FT                   TVDQLRAAHPDRRIDLEMNGNALGVWDGLRLQQVVSNLVLNAIRYGAPDAPVRVVLTGD
FT                   DTEVHLAVRNSGPAIDQLTLARMFDPLSRGPDPEDKHAHGLGLGLGLGLYIASEIARAH
FT                   HGSIDARSDQAETAFEVRLPRRASQTT"
FT   gene            complement(204986..208306)
FT                   /gene="helZ3"
FT                   /locus_tag="PHG186"
FT   CDS_pept        complement(204986..208306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="helZ3"
FT                   /locus_tag="PHG186"
FT                   /product="putative helicase, superfamily II"
FT                   /function="DNA unwinding"
FT                   /note="similar to Azotobacter vinelandii gi:23101871"
FT                   /db_xref="EnsemblGenomes-Gn:PHG186"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85938"
FT                   /db_xref="GOA:Q7WXE8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXE8"
FT                   /protein_id="AAP85938.1"
FT                   /translation="MSVPYQSRQIAQWLDPFTVSKARPYASAVSELRWIDEDTLAGLVQ
FT                   GTRTRPYDVRVYFHDVDDDMWVEGECTCPVGVDCKHVAALLIAGLAHQPKPPSTGVRAE
FT                   LVSWLEGFRARRTAANPAAKKKPSKPTHALAYVIGQSYRGGEVTIYKARVGADGTIRSL
FT                   DDPWQNIEKALVEPPKFVTEADLPILRGLWLGRSHASYMGGFGLRGATGAVILEQLMAT
FT                   GRAFVSFSPAGSHYPGTHCALQVGAARGAQLTWQAQPDTRVRPLLQAEPPASLLLTSTQ
FT                   PCWYVDADAGEAGILAMPWPSEQLADFLSMPAITLDEAALVGNVLRDVAPELPMPPAHE
FT                   TASVRSIHCAPVPVLALDTLSTWASAQDFATVSFDYAGHSLPAHSSTTLLQTTGGEVVQ
FT                   IKRDADLERKRLTELQQAGFRKIRADHVFGPAPFPADMLGPEDHASWPSLVKVLLPILR
FT                   ASGWRVVMTDAFRHNVIEIEAIDGRLRQTGDGWFDVEMGITVNGRTVRLEPLLADLFRR
FT                   DSRWLSGRLDGIPDDEAIDLKTERNERLRLGADRLKPVVRVLIDLFDALNTGMRISEWD
FT                   AARLHALDQTGRWQFDGAASIRQLAQRLMAGPGMADVPVPRGLTAELRAYQRQGLAWMQ
FT                   FLREHGLSGVLADDMGLGKTIQALAHVLTEKERGRLDRPALIVVPTTLVHNWREEAQRF
FT                   TPTLRVLDLHGPQRHDRFDQIGEHDLILTTYALLWRDEAILAGHDYHLLLLDEAQYVKN
FT                   AATKSAATIRTLRARHRLCLTGTPLENHLGELWAQFDFLLPGFLGTRQDFTRRWRTPIE
FT                   KGGDAVRRDLLARRIRPFMLRRRKDEVATELPPKTTIVRTVELEGAQRDLYETVRAAMQ
FT                   EKVRAAVAAKGLARSHIIVLEALLKLRQVCCDPRLVKIKEAARIKESAKLDLLLHMLPE
FT                   LIEEGRRILLFSQFTSMLDLIAAALRNAGIPYVMLTGDTTDRITPVERFQQGEVPLFLI
FT                   SLKAGGVGLNLTAADTVIHYDPWWNPAVENQATDRAHRLGQDKPVFVYKLITGGSVEEK
FT                   IVAMQAQKAALAEAILSEDAAGAVKFSAEDIEALFEPIPAAPAVAATTKSRSRIRTGT"
FT   gene            208995..209420
FT                   /gene="mvpA"
FT                   /locus_tag="PHG187"
FT   CDS_pept        208995..209420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvpA"
FT                   /locus_tag="PHG187"
FT                   /product="putative plasmid maintenance protein"
FT                   /function="plasmid maintenance"
FT                   /note="Pfam:PIN similar to Bradyrhizobium japonicum
FT                   gi:27377545"
FT                   /db_xref="EnsemblGenomes-Gn:PHG187"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85939"
FT                   /db_xref="GOA:Q7WXE7"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXE7"
FT                   /protein_id="AAP85939.1"
FT                   /translation="MVSAVSWLLDTNIVSEAMRPRPEVAVTDNLARYEGELAIPAPVWH
FT                   ELRYGWLRMPDGQRKDAVGRFVQDVVGTLPVLPYDAAAARIHAELRQSRERAGFTLPFV
FT                   DGQIASVAIAHGLTLVTRNTKDFSELTGLRLANWFVP"
FT   gene            210430..211647
FT                   /locus_tag="PHG188"
FT   CDS_pept        210430..211647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG188"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia solanacearum gi:17546566"
FT                   /db_xref="EnsemblGenomes-Gn:PHG188"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85940"
FT                   /db_xref="GOA:Q7WXE6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXE6"
FT                   /protein_id="AAP85940.1"
FT                   /translation="MFVQVSAAAVPRALRGVALVDSNHMPRYWAAVWLVIAGAQWAKST
FT                   QTMRLRYIENLYEHADRSFKANALDDALSDLDDARLADILESWFVSLRNQPVATRSNED
FT                   RWQTGLAFVTSVVTWLSKSADAKMRQIEARIHRLSTLYRQLHIRQGARSETVRSLPSSV
FT                   VESLYQILDPESDANPFQRAHTRWRVFIAFVLMLHQGLRRGELLLLPADAIKSSYDREL
FT                   GRTRYWLNVRQNEYEEVGSDSRYSKPSIKTRHSVRQIPVSDATAGLVQIYCENYRGRPS
FT                   HSFMLSAQTGGPLSTESLTKIFTTISKALPADVLKELHDRTEKKSVTCHDLRHTSAVLR
FT                   LHQLLERGDSMPEALQKLRTFFGWSKESDMPSRYARAVFESRLASVWNDAFDDRVALLR
FT                   ALPQGR"
FT   gene            211833..213182
FT                   /locus_tag="PHG189"
FT   CDS_pept        211833..213182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG189"
FT                   /product="putative phage-type integrase"
FT                   /note="SMART:phage-integrase WU-BLAST2:integrase similar to
FT                   Ralstonia solanacearum gi:17546565"
FT                   /db_xref="EnsemblGenomes-Gn:PHG189"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85941"
FT                   /db_xref="GOA:Q7WXE5"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXE5"
FT                   /protein_id="AAP85941.1"
FT                   /translation="MGRLDFGRYPAVYGALQKHLLVFLLGEDVHISTCFNVLSAAMHLE
FT                   VHDVDRVVAAGPTRIATIWMALRACQLPVHAYRFVKTVLRLLCRHRLHGWSESYLTYVS
FT                   AALPGPASDSYAGVRSGDVFLSADEEAVIVRYLDETSDLVRTRGWSGVAHDKLCEAAMV
FT                   LCSYQFAMRPIQVAMLTRRDVRVWQPEPGGEPAVHLTFVMVKQRGRLRKRPMVRRVKQE
FT                   WAVLFTAPVAHADLHGRDASDRVFDVRSNREAGSRIARCVERLIGDDACAMDLRHTAAQ
FT                   RLVDAGASHEELAEFMGHSDVRTGLVYFAASASHAERVNRALGASEIYRRVAKIAHDRF
FT                   ISPEELTQLKGEQQIAGVPHGIPIAGIGGCTSGQPACPYNPVTSCYGCRKFMPLHDKTM
FT                   HESVLAAMREVVSLFEQSSRGDARSPAYLQLQRTIAEIQAVIDQLEGERR"
FT   gene            213179..213793
FT                   /locus_tag="PHG190"
FT   CDS_pept        213179..213793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG190"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia solanacearum gi:17546564"
FT                   /db_xref="EnsemblGenomes-Gn:PHG190"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85942"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXE4"
FT                   /protein_id="AAP85942.1"
FT                   /translation="MNPHYSAFIELGKALVREKSLQWDIPLDSLAEDLDQIEIPQDVEI
FT                   LLGEKAGTVARLIKGGKASGPIVDAFRRIQKTEGDAAAYEYLRAEADGFHATPYGHCLN
FT                   SFTVDPCAKHLECFADCRHLSATDLPEHRRNLIRLEGQLKLAVETIKARPSTSIGWKNQ
FT                   LDHAEKRLAGVQGLLQTQPGKRPFPDGIDLSLPRRRGVLDE"
FT   gene            213786..214265
FT                   /locus_tag="PHG191"
FT   CDS_pept        213786..214265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG191"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia solanacearum gi:17546563"
FT                   /db_xref="EnsemblGenomes-Gn:PHG191"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85943"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXE3"
FT                   /protein_id="AAP85943.1"
FT                   /translation="MNKTNEVSSADDGKMREILEVLLTDDEDITARAVARLHPSIRAAS
FT                   SITRSESRRRLLAEYQQRQAEYRRWRGRAAKQSGADMAATLADKDLRIAELEATVQLLT
FT                   ASHVATLRAVGELGGFSKWARFYEQYRDARDKLAELGAIPEAAIVPMQENSKRRN"
FT   gene            214377..214877
FT                   /locus_tag="PHG192"
FT   CDS_pept        214377..214877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG192"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85944"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXE2"
FT                   /protein_id="AAP85944.1"
FT                   /translation="MSYCPFFQTLHDETRPVGNLGRGTHYSILRAPVWHDELLNRLDRC
FT                   AFLDLAVIWDEDHDDRVIDALMMLYVGGLLSPVRYIGERKGTLSVLLAPDAMRTWTPKA
FT                   LQQYRDDIENVCQCLEDPWTAKVDAIDGREHSIIHSSAENVSIYLRNIDVLWELGVKPK
FT                   TRS"
FT   gene            215214..215642
FT                   /locus_tag="PHG193"
FT   CDS_pept        215214..215642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG193"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Rhodospirillum rubrum gi:22965786"
FT                   /db_xref="EnsemblGenomes-Gn:PHG193"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85945"
FT                   /db_xref="InterPro:IPR011979"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXE1"
FT                   /protein_id="AAP85945.1"
FT                   /translation="MLVVSPENISAVMALSPPRLSIAELDAAVREGLPKSALREIVDHV
FT                   VRTSEERRALMSRIVPEATFKRRRDRLTPDESEKTERLARIFATANFVWDDEDDARAFL
FT                   NAAHPLLGGSKPLDVAMTELGARRVEELLWRLFYGMSA"
FT   gene            215642..216109
FT                   /locus_tag="PHG194"
FT   CDS_pept        215642..216109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG194"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Mesorhizobium loti gi:13488211"
FT                   /db_xref="EnsemblGenomes-Gn:PHG194"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85946"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXE0"
FT                   /protein_id="AAP85946.1"
FT                   /translation="MRIFRIADRRHEVWNGTGAMLVGGRFNSPGRPVIYGALSFAGAML
FT                   EVLVHARIGKVPRHHVLVIGSVPEDVSVERVDVGQLPTGWDTQEDPRAARSFGDRWLAE
FT                   GRSAVLLVPSVVARGEWNALVNPTHPDAPRIQVSAPEPVQWDDRLFTPHSL"
FT   gene            216455..216844
FT                   /locus_tag="PHG195"
FT   CDS_pept        216455..216844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG195"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85947"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXD9"
FT                   /protein_id="AAP85947.1"
FT                   /translation="MRAALARRYGVVPQLLQETEGGIGMRRSQFGAFLDGLAPAFGDRI
FT                   GQHPNGTPLYRRYGGIEAGAIASLTYRAAPYLPARRARVLSLFNGPSGPTADVEVEEVI
FT                   RGRTKICARWVSVADLHPFPVEVPA"
FT   gene            complement(217291..217665)
FT                   /locus_tag="PHG196"
FT   CDS_pept        complement(217291..217665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG196"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia solanacearum gi:17547034"
FT                   /db_xref="EnsemblGenomes-Gn:PHG196"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85948"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXD8"
FT                   /protein_id="AAP85948.1"
FT                   /translation="MATARAGTRGEALKLLEAEGVTVVELDYELGWQDAVELGRLGDKV
FT                   GVRVEYRGHESIAVRSPAALVAGLLRPKTTFRQRNLYCQFEFDELPAGELDRLEAKAAT
FT                   MGDYILARHLLREVDAEWVE"
FT   gene            complement(218450..219022)
FT                   /locus_tag="PHG197"
FT   CDS_pept        complement(218450..219022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG197"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Bradyrhizobium japonicum gi:27377582"
FT                   /db_xref="EnsemblGenomes-Gn:PHG197"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85949"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXD7"
FT                   /protein_id="AAP85949.1"
FT                   /translation="MTDQLAIWHADHINFAALLDLLEEQVSVFHRGEQPNYSLIGTIIY
FT                   YMRNFGDRVHHPREDVAYALLVERDPGMQIVVSRLLQEHRIIARVREELLSRLNEAERD
FT                   VITSRAALEAAAAMYLVYYRNHLSTEERHVMPRAAQQLTEEDWAEVATTVPDSPDPLFG
FT                   ENIQERFAALRKQLEGEAKASRQESIH"
FT   gene            complement(219089..219505)
FT                   /locus_tag="PHG198"
FT   CDS_pept        complement(219089..219505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG198"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85950"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXD6"
FT                   /protein_id="AAP85950.1"
FT                   /translation="MVHALAPWANNADHQAMLVTEGADAQPSLAPLGQHLPPEGIAPAS
FT                   QAVAAMATSKDRDQVVTTGRRPHRADRRACRAHRAHRAGATGRRPSMAAQKRKSVMPGF
FT                   EQGPLCRHRRVGEWATPTIDLNQPQMVTGDYCSD"
FT   gene            220000..220242
FT                   /locus_tag="PHG199"
FT   CDS_pept        220000..220242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG199"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to N-terminus of Pseudomonas fluorescens
FT                   gi:23060226; putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PHG199"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85951"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXD5"
FT                   /protein_id="AAP85951.1"
FT                   /translation="MLAVAVQTVCNGIIGSVAHVHNVEVLLCFAQVVSIVDDDEAMRIA
FT                   TASLVRSFGKPTRQFASAEEFLQSGHIAETSCLTS"
FT   gene            complement(220764..221975)
FT                   /gene="fhp"
FT                   /locus_tag="PHG200"
FT   CDS_pept        complement(220764..221975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhp"
FT                   /locus_tag="PHG200"
FT                   /product="flavohemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG200"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85952"
FT                   /db_xref="GOA:P39662"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="PDB:1CQX"
FT                   /db_xref="PDB:3OZU"
FT                   /db_xref="PDB:3OZV"
FT                   /db_xref="PDB:3OZW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39662"
FT                   /protein_id="AAP85952.1"
FT                   /translation="MLTQKTKDIVKATAPVLAEHGYDIIKCFYQRMFEAHPELKNVFNM
FT                   AHQEQGQQQQALARAVYAYAENIEDPNSLMAVLKNIANKHASLGVKPEQYPIVGEHLLA
FT                   AIKEVLGNAATDDIISAWAQAYGNLADVLMGMESELYERSAEQPGGWKGWRTFVIREKR
FT                   PESDVITSFILEPADGGPVVNFEPGQYTSVAIDVPALGLQQIRQYSLSDMPNGRSYRIS
FT                   VKREGGGPQPPGYVSNLLHDHVNVGDQVKLAAPYGSFHIDVDAKTPIVLISGGVGLTPM
FT                   VSMLKVALQAPPRQVVFVHGARNSAVHAMRDRLREAAKTYENLDLFVFYDQPLPEDVQG
FT                   RDYDYPGLVDVKQIEKSILLPDADYYICGPIPFMRMQHDALKNLGIHEARIHYEVFGPD
FT                   LFAE"
FT   gene            complement(222203..222637)
FT                   /locus_tag="PHG201"
FT   CDS_pept        complement(222203..222637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG201"
FT                   /product="hypothetical protein"
FT                   /note="N-terminus similar to central part of Ralstonia
FT                   metallidurans gi:22977826"
FT                   /db_xref="EnsemblGenomes-Gn:PHG201"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85953"
FT                   /db_xref="GOA:Q7WXD3"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXD3"
FT                   /protein_id="AAP85953.1"
FT                   /translation="MQWLAGDAAPSGFTVDQEIELQSGAESKATVRYVRHPLDAENLRR
FT                   HIAAGKRCTRLAMTWNVISGHRRAGHACAPRPAMRPAPPRPSATRHAPRPRPRAKRSRR
FT                   SRRNWPRRGRRTTGQCGTERGVFSRRIAPSGLRRRLSQLQ"
FT   gene            223902..224468
FT                   /gene="phaP2"
FT                   /locus_tag="PHG202"
FT   CDS_pept        223902..224468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaP2"
FT                   /locus_tag="PHG202"
FT                   /product="Phasin"
FT                   /note="similar to Burkholderia fungorum gi:22990143"
FT                   /db_xref="EnsemblGenomes-Gn:PHG202"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85954"
FT                   /db_xref="InterPro:IPR010127"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXD2"
FT                   /protein_id="AAP85954.1"
FT                   /translation="MTQWTAEQCTKAQMAGLEAMAGLTNKVLEGFEKVMDLNLQTMKMT
FT                   LAHNREGVMKALSVQNPQELIELQIELFQPAADKVLEYRRQLHDILAATRAEFEKIAEV
FT                   QYTTSKGQLQGLIDSAVSNAPSGSTAPLAAWQEAVKATTALYESMQSTAKQAVEVAENS
FT                   FNTAAAAASKGARHRAALASPAAAK"
FT   gene            224739..225356
FT                   /locus_tag="PHG203"
FT   CDS_pept        224739..225356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG203"
FT                   /product="hypothetical protein"
FT                   /note="similar to C-terminus of fumarate reductase
FT                   flavoprotein subunits; Streptococcus mutans gi:24378694,
FT                   Clostridium tetani gi:28211164"
FT                   /db_xref="EnsemblGenomes-Gn:PHG203"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85955"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXD1"
FT                   /protein_id="AAP85955.1"
FT                   /translation="MLTLSIYKGGIAVNRDAEWFADESISYKTLGEICLAQPGGVGFQI
FT                   CEQKIMAQSAPQPTSNNLEEAYRRGPVRKADELVSLGKSVGLDGERLQQIVQRYNSDVA
FT                   NGRDSVFGRSGLWRRWGKLIAIDTAPFYIYPCITAILATYCGLKVDADMRVIDIQGAQI
FT                   PRLHAAGEVVGGFHGSGYMSGSSLSESVIFGRVAARTVLEGA"
FT   gene            225353..225700
FT                   /locus_tag="PHG204"
FT   CDS_pept        225353..225700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG204"
FT                   /product="hypothetical protein"
FT                   /function="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG204"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85956"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXD0"
FT                   /protein_id="AAP85956.1"
FT                   /translation="MKPTVLLILAHPDKRGFGGALAEAYVKPLQAQGCDVEVLHLPAME
FT                   FDATPAGRPPELEADLVRARAAIQRAVTSHSFTLPGSGRCQPGSKGSSSASSATTSPSS
FT                   SSRNRCSRSRS"
FT   gene            225604..225960
FT                   /locus_tag="PHG205"
FT   CDS_pept        225604..225960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG205"
FT                   /product="hypothetical protein"
FT                   /function="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG205"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85957"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXC9"
FT                   /protein_id="AAP85957.1"
FT                   /translation="MPARLKGFFERVFGNDFAFKFKPKSLFPESFLTGRSADILVTMDT
FT                   PPWIYRFLLGAPGHRLIRHAILGPSGIRPIKIMTFGPLRASSDGQRQRWLARAQARATS
FT                   IAKRLNAGARTTPA"
FT   gene            226325..226525
FT                   /locus_tag="PHG206"
FT   CDS_pept        226325..226525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG206"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Burkholderia fungorum gi:22988055,
FT                   Ralstonia metallidurans gi:22978336"
FT                   /db_xref="EnsemblGenomes-Gn:PHG206"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85958"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXC8"
FT                   /protein_id="AAP85958.1"
FT                   /translation="MLSPHEIAALLLLDDAQEIHDLEPEHLDSLLVHKLVTLEHGHDTG
FT                   NAYPRLTSQGHSMLDAVRRIR"
FT   gene            complement(226859..227335)
FT                   /locus_tag="PHG207"
FT   CDS_pept        complement(226859..227335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG207"
FT                   /product="putative transposase"
FT                   /note="similar to C-terminus of putative transposases;
FT                   Mesorhizobium loti gi:13488118, Escherichia coli
FT                   gi:18265863"
FT                   /db_xref="EnsemblGenomes-Gn:PHG207"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85959"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXC7"
FT                   /protein_id="AAP85959.1"
FT                   /translation="MQGWALSRRPATPAARALCQHERADRRSLALRASAPAHGLARRDA
FT                   LRALIGRQTASGQHHQERQQLCQKAAGRGSPELPVPARVSPEIQRRHERIPKAILDRAW
FT                   DAQVLLCRRYRKLAARGKIPNMAVVAVARELSGFIWDISRLAMSLAVPHEARAT"
FT   gene            complement(226930..227505)
FT                   /locus_tag="PHG208"
FT   CDS_pept        complement(226930..227505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG208"
FT                   /product="putative transposase"
FT                   /note="similar to C-terminus of putative transposases;
FT                   Geobacter metallireducens gi:23056465; Pfam:Transposase_20"
FT                   /db_xref="EnsemblGenomes-Gn:PHG208"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85960"
FT                   /db_xref="GOA:Q7WXC6"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXC6"
FT                   /protein_id="AAP85960.1"
FT                   /translation="MQHLADLAGDRPEAASLCDAEQLGALYLSPPASPVKSSRPGRECR
FT                   RTRLALVFHAPACRDGLYRGGLRRPRHVHYANMNAPIADLSRFAHPRQLMAWLGVTPSE
FT                   HSSGDKRRQGSITKNGNSYARKLLVEAARSYRYLHASVPRSSAGTNASPKLSLTVPGTP
FT                   RFYCAGAIGSSLRAERSRTWRWSQWPAN"
FT   gene            227601..227768
FT                   /gene="napE"
FT                   /locus_tag="PHG209"
FT   CDS_pept        227601..227768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napE"
FT                   /locus_tag="PHG209"
FT                   /product="periplasmic nitrate reductase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG209"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85961"
FT                   /db_xref="GOA:Q7WXC5"
FT                   /db_xref="InterPro:IPR004448"
FT                   /db_xref="InterPro:IPR010649"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXC5"
FT                   /protein_id="AAP85961.1"
FT                   /translation="MMESGEVHDPQRKKEELRSFLFLTAVMVPVLSVIVVAGYGFIVWM
FT                   SQLVGGPPSH"
FT   gene            227844..228173
FT                   /gene="napD"
FT                   /locus_tag="PHG210"
FT   CDS_pept        227844..228173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napD"
FT                   /locus_tag="PHG210"
FT                   /product="periplasmic nitrate reductase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG210"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85962"
FT                   /db_xref="GOA:Q7WXC4"
FT                   /db_xref="InterPro:IPR005623"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXC4"
FT                   /protein_id="AAP85962.1"
FT                   /translation="MPTAKRAIPIQPLPCGEEWHIAGIVVHTLPDSLPQVRAAIEAITG
FT                   AEIHAVSDDGKLVVTVEAPTSRAIAAHLTCLHQLEGVLSAALVYQHNEDAAAMNEEMAD
FT                   EDLSS"
FT   gene            228154..230649
FT                   /gene="napA"
FT                   /locus_tag="PHG211"
FT   CDS_pept        228154..230649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA"
FT                   /locus_tag="PHG211"
FT                   /product="periplasmic nitrate reductase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PHG211"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85963"
FT                   /db_xref="GOA:P39185"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="PDB:3ML1"
FT                   /db_xref="PDB:3O5A"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39185"
FT                   /protein_id="AAP85963.1"
FT                   /translation="MKISRRDFIKQTAITATASVAGVTLPAGAANFVTDSEVTKLKWSK
FT                   APCRFCGTGCGVTVAVKDNKVVATQGDPQAEVNKGLNCVKGYFLSKIMYGQDRLTRPLM
FT                   RMKNGKYDKNGDFAPVTWDQAFDEMERQFKRVLKEKGPTAVGMFGSGQWTVWEGYAAAK
FT                   LYKAGFRSNNIDPNARHCMASAAAGFMRTFGMDEPMGCYDDFEAADAFVLWGSNMAEMH
FT                   PILWTRVTDRRLSHPKTRVVVLSTFTHRCFDLADIGIIFKPQTDLAMLNYIANYIIRNN
FT                   KVNKDFVNKHTVFKEGVTDIGYGLRPDHPLQKAAKNASDPGAAKVITFDEFAKFVSKYD
FT                   ADYVSKLSAVPKAKLDQLAELYADPNIKVMSLWTMGFNQHTRGTWANNMVYNLHLLTGK
FT                   IATPGNSPFSLTGQPSACGTAREVGTFSHRLPADMVVTNPKHREEAERIWKLPPGTIPD
FT                   KPGYDAVLQNRMLKDGKLNAYWVQVNNNMQAAANLMEEGLPGYRNPANFIVVSDAYPTV
FT                   TALAADLVLPSAMWVEKEGAYGNAERRTQFWHQLVDAPGEARSDLWQLVEFAKRFKVEE
FT                   VWPPELIAKKPEYKGKTLYDVLYRNGQVDKFPLKDVNAEYHNAEAKAFGFYLQKGLFEE
FT                   YATFGRGHGHDLAPFDAYHEARGLRWPVVNGKETRWRYREGSDPYVKAGTGFQFYGNPD
FT                   GKAVIFALPYEPPAESPDKEYPYWLVTGRVLEHWHSGSMTRRVPELYRSFPNAVVFMHP
FT                   EDAKALGLRRGVEVEVVSRRGRMRSRIETRGRDAPPRGLVFVPWFDASQLINKVTLDAT
FT                   CPISLQTDFKKCAVKIVKV"
FT   gene            230681..231190
FT                   /gene="napB"
FT                   /locus_tag="PHG212"
FT   CDS_pept        230681..231190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napB"
FT                   /locus_tag="PHG212"
FT                   /product="periplasmic nitrate reductase small subunit"
FT                   /function="diheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:PHG212"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85964"
FT                   /db_xref="GOA:P39186"
FT                   /db_xref="InterPro:IPR005591"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="PDB:3ML1"
FT                   /db_xref="PDB:3O5A"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39186"
FT                   /protein_id="AAP85964.1"
FT                   /translation="MKPSRSWASLLAVCAVLLAALAMQAIFFPAPARAQGLVDAMRGPT
FT                   AIANEPRAPLLYPTENKDIRRTRNYTMQPPTIPHKIDGYQLDKDFNRCMFCHARTRTEE
FT                   TQAIPVSITHYMDRDNNVLADVSPRRYFCTQCHVPQADTKPLIGNNFVDVDTILKRRPG
FT                   AKGAAK"
FT   gene            231212..231799
FT                   /gene="napC"
FT                   /locus_tag="PHG213"
FT   CDS_pept        231212..231799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napC"
FT                   /locus_tag="PHG213"
FT                   /product="periplasmic nitrate reductase transmembrane
FT                   protein"
FT                   /note="Pfam entry PF03264"
FT                   /db_xref="EnsemblGenomes-Gn:PHG213"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85965"
FT                   /db_xref="GOA:Q7WXC2"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR011885"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXC2"
FT                   /protein_id="AAP85965.1"
FT                   /translation="MLDLIKRYWRTINRPSAYFSLGFLTLGGFIAGVMFWGAFNTALEL
FT                   TNTEQFCTGCHEMRDNVYQELQGTIHFTNRSGVRAKCSDCHVPHNWTTKMARKMQASKE
FT                   VWGKVFGTIDTREKFQAHRLTLAQHEWARFKANDSLECRNCHDYQSMDFTRQSPRAQAM
FT                   HSTYLANKEKTCIDCHKGIAHHLPDVSKAGEK"
FT   gene            231803..232486
FT                   /gene="ccmA"
FT                   /locus_tag="PHG214"
FT   CDS_pept        231803..232486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="PHG214"
FT                   /product="ABC heme export system atp-binding protein"
FT                   /function="C-type cytochrome biogenesis"
FT                   /note="FrameD picked start at codon 40, start picked
FT                   further upstream based on alignment"
FT                   /db_xref="EnsemblGenomes-Gn:PHG214"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85966"
FT                   /db_xref="GOA:Q7WXC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WXC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAP85966.1"
FT                   /translation="MPARSPEPLPDHSSVCSPGCADLPILAASGLGFSRAGRVVFSGID
FT                   LALGPGDLLQVLGANGSGKTSLLRVLSGLVAPDEGELHWRGRPVRAGDPSLLQALAYVG
FT                   HANGIDPELSPVENLRFAARLAGVAATPDNVQAALAAFGLERVMHAPARSLSQGLRRRA
FT                   ALARLALARRELWLLDEPVTSLDADAAARFQAQLDDHLRAGGMAIVATHALLPGARTLR
FT                   LDARS"
FT   misc_feature    231920
FT                   /gene="ccmA"
FT                   /locus_tag="PHG214"
FT                   /note="alternate site of translation initiation"
FT   gene            232483..233160
FT                   /gene="ccmB"
FT                   /locus_tag="PHG215"
FT   CDS_pept        232483..233160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /locus_tag="PHG215"
FT                   /product="ABC heme export system"
FT                   /function="C-type cytochrome biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PHG215"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85967"
FT                   /db_xref="GOA:Q7WXC0"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXC0"
FT                   /protein_id="AAP85967.1"
FT                   /translation="MTRTLAAIIMHDLSLSWRRRGSLLGSVVFFVIATSLFPLAVGPDL
FT                   QQLRALAPGILWVAALLASMLSLSRLFSQEYADGSLDQLLLSPHPLALLVLAKICAHWL
FT                   TSGLPLLLLTPLLAQQYSLPAGSSFLLAASLLVGTPALSLIGAVGAALTLGVRGGTVLL
FT                   CILVLPLCVPVLVFGASAGAGADAGLEVLPQFSLLGACLALSLFLCPLATAAGLRTAME
FT                   SSG"
FT   gene            233157..233957
FT                   /gene="ccmC"
FT                   /locus_tag="PHG216"
FT   CDS_pept        233157..233957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /locus_tag="PHG216"
FT                   /product="ABC heme export system"
FT                   /function="C-type cytochrome biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PHG216"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85968"
FT                   /db_xref="GOA:Q7WXB9"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXB9"
FT                   /protein_id="AAP85968.1"
FT                   /translation="MSPPLNPAHGGNAAPPALRSRWLAYAAPVRFYPLAGRLAPWCFAA
FT                   AAIFLLTGLYVGFAVSPTDAQQGEVYRIIFIHVPAAWMSMFIYLVMAGYCALALVLRTR
FT                   LSSMMASALAPTGALFTALALWTGALWGQPTWGTWWVWDARLTSELMLLFLYLGFIALE
FT                   AAIDEPRRAERACAVLALVGVVNIPVIYFSVQWWNTLHQGASVSLTAAPSMAATMLAGM
FT                   LLMTLACWMYTIAVALVRVRCILRERGEVSDAGHAPANPRETTT"
FT   gene            234091..234558
FT                   /gene="ccmE"
FT                   /locus_tag="PHG217"
FT   CDS_pept        234091..234558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmE"
FT                   /locus_tag="PHG217"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /function="C-type cytochrome biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PHG217"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85969"
FT                   /db_xref="GOA:Q7WXB8"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WXB8"
FT                   /protein_id="AAP85969.1"
FT                   /translation="MTPRRRRLGLLLAALICVGIATTLVLNAFRSNLVFFFSPSQVAAH
FT                   EAPVARSFRLGGLVAPGSIRREGDGMTIRFIVTDTARQVLVVYRGLLPDLFREGKGVVA
FT                   RGKLEADGTFVASEVLAKHDENYMPPEAADALKQAEQVNRRMAGTPQGARQ"
FT   gene            234555..236570
FT                   /gene="ccmF"
FT                   /locus_tag="PHG218"
FT   CDS_pept        234555..236570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmF"
FT                   /locus_tag="PHG218"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /function="C-type cytochrome biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PHG218"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85970"
FT                   /db_xref="GOA:Q7WXB7"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXB7"
FT                   /protein_id="AAP85970.1"
FT                   /translation="MNAELGHFALIVALLVAIVQAALPLAGAAHGNIAWMAVARPAARV
FT                   QCVLVALAFGSLTWAFVSNDFSVRYVAANANTALPLTYRIAAVWGGHEGSMLLWTLMLG
FT                   LWSTAVSFCSRQRPLAVVARVLGVMGTISAGFLLFLLFASNPFLRLLPPAMEGRDLNPL
FT                   LQDPGMVFHPPLLYMGYVGFSVTFAFAVAALLAGRADAAWARWSRPWTTVAWALLTLGI
FT                   MLGSAWAYYELGWGGWWFWDPVENASFMPWLAGTALMHSLAVTEKRGAFRAWTVLLAIF
FT                   TFSLSLLGTFLVRSGVLTSVHAFAVDPKRGIFILALLGLVTGLSLTLYGWRAPRLARRV
FT                   EFSVAARESLLLANNVLLAVAAATVLLGTLYPLLLDVLGLGKISVGPAYFEQVFVPLMA
FT                   PAVLLMGAAPLARWRHGGLPDMARRLRWAAAASIVVGLGLLLVQRNASALAGLGLVLAA
FT                   WCGLSAVASLSTRLRNQQGRRLAALRQLPASYWGMLLSHAGVGVFIAGVTLVSSQESLR
FT                   ELPMRVGHNISVGGYSFRFDGVTQAAGPNYDALRGTLSVSRHGKIVAVLAPERRIYRSQ
FT                   DMPTTEAAIDSGLTRDLYVALGEGVGDGGWAVRIHVKPFVDWIWAGCILMALGGLLAVC
FT                   DKRYRLRRRAPAPQAETVDAPKAPALALSTAEETRA"
FT   gene            236567..237109
FT                   /gene="ccmG"
FT                   /locus_tag="PHG219"
FT   CDS_pept        236567..237109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmG"
FT                   /locus_tag="PHG219"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /function="C-type cytochrome biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PHG219"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85971"
FT                   /db_xref="GOA:Q7WXB6"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXB6"
FT                   /protein_id="AAP85971.1"
FT                   /translation="MTRFLLPLAAFLALTIALAAGLRHDPRELPSPLVGKPAPAFSLPL
FT                   LEPEGRTLAAADMRGKVWLLNVWASWCAACRTEHPVLVDFAARSHVPLYGLNYKDETGA
FT                   ARDWLQRMGNPYAASLVDADGRVGIDYGVYGVPETFVIDQSGVVRYRQAGPVTREVLER
FT                   KLMPLIEQLEKSGDGHA"
FT   gene            237102..237590
FT                   /gene="ccmL"
FT                   /locus_tag="PHG220"
FT   CDS_pept        237102..237590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmL"
FT                   /locus_tag="PHG220"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /function="C-type cytochrome biogenesis"
FT                   /note="FrameD picked start at codon 8, start picked further
FT                   upstream based on alignment"
FT                   /db_xref="EnsemblGenomes-Gn:PHG220"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85972"
FT                   /db_xref="GOA:Q7WXB5"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAP85972.1"
FT                   /translation="MRRRFGSLLSAVICGLALHAGAATLSDTELDARVHALSGQLRCLV
FT                   CQNQTLADSNADLAVDLRRQIRERLRGGASDEAVKDYLVQRYGDFVLYKPPLRPLTWLL
FT                   WFGPLLLVAGVTIAIIRARSRSVAAGLPLDAEAQRQLAALLDETSGQPASPPAEARQP"
FT   misc_feature    237123
FT                   /gene="ccmL"
FT                   /locus_tag="PHG220"
FT                   /note="alternate site of translation initiation"
FT   gene            237587..238834
FT                   /gene="ccmH"
FT                   /locus_tag="PHG221"
FT   CDS_pept        237587..238834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmH"
FT                   /locus_tag="PHG221"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /function="C-type cytochrome biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PHG221"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85973"
FT                   /db_xref="GOA:Q7WXB4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXB4"
FT                   /protein_id="AAP85973.1"
FT                   /translation="MTTFWLLAAALIAATMACLLWPLLRHRVAPDPDTPERALLADLYR
FT                   EQLNELDTDLQSGTLTAARHAGARDELARRLLDENASATAAARQAKPSPLLAAALLAVL
FT                   PSAAILLYLHLGNPVAQWSANDMPAATDGQHQLSGLQLEGMVNQLAKRLRDAPGDAEGW
FT                   AMLARSYSVMERHDDAAAAYAKAIALAPDVAPLRSDYADVLASLNGGSLEGAPMEQIGR
FT                   ALALDPDDPKGLALAASAAAERGDTQGAIGYWEHLYRLLPADSQTAARIAANLAAARGT
FT                   AATSLTASGEIGGIVTLGEMAGRIPRPDETVFIYARAVDGPRMPLAVIRRTVRDLPARF
FT                   TLDDSMALGPDHKLTGYPRLMVEARISASGNATPQAGDLVGRTGPVAAGSHEVQIVIDS
FT                   IVPDAGTAPAADRIPH"
FT   gene            239335..240561
FT                   /locus_tag="PHG222"
FT   CDS_pept        239335..240561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG222"
FT                   /product="probable acyl-coa dehydrogenase"
FT                   /note="similar to Ralstonia solanacearum gi:17546739,
FT                   Burkholderia fungorum gi:22983219"
FT                   /db_xref="EnsemblGenomes-Gn:PHG222"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85974"
FT                   /db_xref="GOA:Q7WSB2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WSB2"
FT                   /protein_id="AAP85974.1"
FT                   /translation="MQFEYTPKVKEMQAKLLAFFERHIYPNEQRFEEEIDANRRAGNAW
FT                   IPSTVIDELKPRAREAGLWNLFLPRSPRAAQGLSNLEYAPLCEIMGRVPWSAEVFNCSA
FT                   PDTGNMETLERYASEELKDQWLEPLLAGEIRSAFLMTEPAVASSDATNIACRIERDGDH
FT                   YVINGTKWWSSGAGDPRCKVYIVMGKSNPDAARHEQQSMIVVPADAPGVTVKRFVPVFG
FT                   YDHAPHGHMEIELKNVRVPASNILLGEGRGFEMAQGRLGPGRIHHCMRSIGAAERTLEL
FT                   MCKRSLDRVAFGKEIARHGVTQERIAEARCEIEMARLLTLKAGYMMDTVGNKVAKAEIA
FT                   MIKVVAPNVALKVIDWAIQVHGAAGVSSDFPLASWWAHQRTLRLADGPDEVHRNAIAKL
FT                   ELLKYRSDR"
FT   gene            complement(241141..241629)
FT                   /locus_tag="PHG223"
FT   CDS_pept        complement(241141..241629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG223"
FT                   /product="putative transposase"
FT                   /note="similar to C-terminus of putative transposases;
FT                   Sphingomonas sp. gi:05578707, Paracoccus pantotrophus
FT                   gi:27802461"
FT                   /db_xref="EnsemblGenomes-Gn:PHG223"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85975"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXB3"
FT                   /protein_id="AAP85975.1"
FT                   /translation="MERQAEAARAVADALPMLRLASIVSIVVVSNSDGEPDEESGARLA
FT                   SWLASHGVGAEMRLKSKPAARNLDPTARRGGAWSERTPGAQWRNEAIDAIARNWRGEWK
FT                   RGCGYHCRSLIENLMYRLKTSIAFGRVASASQSTEVAIRVGVLNRMVALARPQSVRIA"
FT   gene            complement(241747..242085)
FT                   /locus_tag="PHG224"
FT   CDS_pept        complement(241747..242085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG224"
FT                   /product="hypothetical protein"
FT                   /note="similar to N-terminus of Ralstonia metallidurans
FT                   gi:22976193"
FT                   /db_xref="EnsemblGenomes-Gn:PHG224"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85976"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXB2"
FT                   /protein_id="AAP85976.1"
FT                   /translation="MNFRTMLVDLREDDARDARIEAAAGLALLFDGSIVGLTATGTQLE
FT                   PYRGAGEEAGKYAALAAEHYAVLRDLVKQAAPSIPIRQAVVEAEEGWALAREGRFADII
FT                   LPDAAVHR"
FT   gene            complement(242351..242947)
FT                   /locus_tag="PHG225"
FT   CDS_pept        complement(242351..242947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG225"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to central part of Ralstonia solanacearum
FT                   gi:17544920, Ralstonia metallidurans gi:22976194"
FT                   /db_xref="EnsemblGenomes-Gn:PHG225"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85977"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXB1"
FT                   /protein_id="AAP85977.1"
FT                   /translation="MLVESPYGDRLHPGGDPIGILGEIISRTIGRGDSLIIPAFAVGRT
FT                   QSLLYCLHRLRELKRIPEVPVYLNSPMAIDATTIFSLHPEELHIDRAACADACGLATPV
FT                   QSMEQSVWLNRDRSPKIILAGSGMATGGRMHHLAAYGQDPAQHDPAVGLPGGRNGEPHW
FT                   PRASATSGSTGRTSSCARRSSRSRISRRMPMRPSW"
FT   gene            complement(242952..243551)
FT                   /locus_tag="PHG226"
FT   CDS_pept        complement(242952..243551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG226"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to N-terminus of Ralstonia solanacearum
FT                   gi:17544920, Ralstonia metallidurans gi:22976194"
FT                   /db_xref="EnsemblGenomes-Gn:PHG226"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85978"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXB0"
FT                   /protein_id="AAP85978.1"
FT                   /translation="MQLQFLGATDTVTGSRYVLDTGRDRVMVDCGLFQGYKTLRLRNWD
FT                   PLPVDPASLDGVVLTHAHLDHSGYLPLLVRNGFRGSAYCTMGTAQLCGILLPDSAHLAA
FT                   EDAAYANRKGFSRHRPTLPPYTSADVEHALRRLGPTHYGQHFTVVPGVEAEFSRAGHIV
FT                   GSAIVTLLAQGQRIVFSGDLGRQHDLVMRAPEAEAG"
FT   gene            complement(243812..244924)
FT                   /locus_tag="PHG227"
FT   CDS_pept        complement(243812..244924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG227"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative transmembrane protein, similar to
FT                   C-terminus of Ralstonia solanacearum gi:17544901,
FT                   Pseudomonas fluorescens gi:23062939; Pfam entry PF02308"
FT                   /db_xref="EnsemblGenomes-Gn:PHG227"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85979"
FT                   /db_xref="GOA:Q7WXA9"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXA9"
FT                   /protein_id="AAP85979.1"
FT                   /translation="MDPLILSVSVALGIGLAIGLERERSQSAADGGEDPAGLRTFAVAS
FT                   LSGAICAMLPDRLLLPLALLGATVLAAISYQRSANRDAGLTTEFASAHHPAGRVDSDAR
FT                   SAGGGLCHCRGALAAWQGVPASHRAQRRHPRGNERCADPGCGSPDRLAAAARPLHGAAR
FT                   RLESACALAGRAAGAAGRAAGHIFARMFGEHFGLPMTGLFGGFVSSVATIGAMAVRARK
FT                   ADSPVHGPVAAALLSTVATFIQITLLLGATSVSALQALALPLAAGLLAIAACGGVWLWR
FT                   ALRETPAAGEGLLAGRSFDWRGAGGFALLFGVLQLVGAATQAWGGNTAYLHWQSGPASR
FT                   TRMPRRHRSGRSWEPESWMTTRRYGRCSAR"
FT   gene            245112..245567
FT                   /locus_tag="PHG228"
FT   CDS_pept        245112..245567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG228"
FT                   /product="conserved hypothetical protein"
FT                   /note="probable universal stress protein, similar to
FT                   Ralstonia metallidurans gi:22976196, Ralstonia solanacearum
FT                   gi:17546223, gi:17544898; Pfam entry PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:PHG228"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85980"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXA8"
FT                   /protein_id="AAP85980.1"
FT                   /translation="MYQRILLAVDGSRSSDLALSQAIIVAKATGAEVKALFVLDDSDIY
FT                   FETSYFDPKELLDNIMADGRKALDAATARLSEAGVGNTAQLVEKPVSPGRISLTIVGEA
FT                   DAWNADLIVLGTHGRRGVRRLLMGSVSEGVIARTSKPVLLVRSETEG"
FT   gene            245601..246626
FT                   /locus_tag="PHG229"
FT   CDS_pept        245601..246626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG229"
FT                   /product="probable alcohol dehydrogenase"
FT                   /note="similar to N-terminus of Ralstonia solanacearum
FT                   gi:17546224, Burkholderia fungorum gi:22984140; Pfam entry
FT                   PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:PHG229"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85981"
FT                   /db_xref="GOA:Q7WXA7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXA7"
FT                   /protein_id="AAP85981.1"
FT                   /translation="MAQTMRAMIFEGAGLPLRLQDVPVPDPGPGEVCIAAAACEVCHTD
FT                   LHIADGDLSHPKPALIPGHEAVGQVESCGTGVTAFSPGERVGVPWLGNTCGDCRYCMHL
FT                   HGNLCDAPQLTGYTRDGGYAEYVVADSSYYFRIPPAYDDEHAEPLLCAGLIDYRTLRMA
FT                   GEAQRIGIYGFGAAAHLVTQIAAAQGREVYGFTRAGDTGAQQLAYETGACWAGSSDLQS
FT                   PVALDAALIFAPVGALVPCALRAVDKGERCRLRRHPHERHPAHALPAAMGRASPVFGRQ
FT                   PHARRRNCVDADRRPDAAADAHDRLPARAGQCGTGRSARGASVRCRRPENPSLRLRQIS
FT                   P"
FT   gene            246178..246603
FT                   /locus_tag="PHG230"
FT   CDS_pept        246178..246603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG230"
FT                   /product="probable alcohol dehydrogenase"
FT                   /note="similar to C- terminus of Ralstonia solanacearum
FT                   gi:17546224, Brucella melitensis gi:17987208"
FT                   /db_xref="EnsemblGenomes-Gn:PHG230"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXA6"
FT                   /protein_id="AAP85982.1"
FT                   /translation="MASLARATPAPSNWPTRPARAGPAPATSSRPWRWMRRLSSPRWVR
FT                   WFPARCAPWTRGSAVVCAGIHMSDIPRMPYQLLWEERRLCSVANLTRADGIALMQIAVR
FT                   TPLQTHTTAYPLEQANAALADLREGRLSGAAVLRIRH"
FT   gene            246623..247966
FT                   /locus_tag="PHG231"
FT   CDS_pept        246623..247966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG231"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative phosphoribosyltransferase, similar to
FT                   Thermobifida fusca gi:23019923, Mycobacterium tuberculosis
FT                   cdc1551 gi:15839969, Mycobacterium tuberculosis h37rv
FT                   gi:15607711; Pfam entry PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:PHG231"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85983"
FT                   /db_xref="GOA:Q7WXA5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXA5"
FT                   /protein_id="AAP85983.1"
FT                   /translation="MSRYQTRFQTREQAGTELALALRPYQGTGALVLAIPRGGVPVGRI
FT                   VADSLGADFDLVMARRIVPGMALDESGATWCTYEANADGATDSQRDAQFDQLRRQRAVY
FT                   MAVRKIADPKGRVVIVVDDGLVSGATMYAALAGLRKRRPARLICAIPIAARAGLDRVRA
FT                   LADEIVCLDTPDRIENLAHFYREFQLVSDDRVRQLTAIQPAQSQARSRPGAVVRMPSLS
FT                   LALQIPYGTSRLPAMLESAPNPMGVALMVCAGGAQRRAARSQYLARKLRAKGFATMLVD
FT                   LQPESRDNDAPESEIDDLARRLNQALIFLRARMPCAKLPAGLLSTGTAGAAALRAAACS
FT                   ADLLGAVACVAGRPDLAGSATLQRLDIPALLMCASGDAQNIHINNLAFEQMHCLRQLRL
FT                   IPTSGRGFEDRNAMEDIATLTADWFGRHLATASPPSLAYGGRQTPPNM"
FT   gene            complement(248496..248858)
FT                   /locus_tag="PHG232"
FT   CDS_pept        complement(248496..248858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG232"
FT                   /product="putative acetyl-coa acetyltransferase"
FT                   /note="similar to central part of Ralstonia solanacearum
FT                   gi:17544995, Ralstonia metallidurans gi:22978769, Brucella
FT                   suis 1330 gi:23500197"
FT                   /db_xref="EnsemblGenomes-Gn:PHG232"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85984"
FT                   /db_xref="GOA:Q7WSB1"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WSB1"
FT                   /protein_id="AAP85984.1"
FT                   /translation="MLDMSVWSQGAQRYRPGRAMGTFGEDCAAKCQFSREAQDPFAMTS
FT                   VTGAKQAMESGAFAAEITPVTVKDRAGERVVSVDEGPGKVRLDRIPHPKPAFRNDGPLP
FT                   GICRQSLMIDAASPAI"
FT   gene            249125..249637
FT                   /locus_tag="PHG233"
FT   CDS_pept        249125..249637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG233"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Neisseria meningitidis z2491 gi:15794625,
FT                   Haemophilus influenzae rd gi:16272203"
FT                   /db_xref="EnsemblGenomes-Gn:PHG233"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85985"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXA4"
FT                   /protein_id="AAP85985.1"
FT                   /translation="MFSPTASLPGFDSPIELLLACHEKVRRFAGLCQRLEQHAALHGAD
FT                   DEARTAAASVLRYFQIAAPLHHADEEEDLFPALRELGDVSLTARIDELDAEHGRLGDLW
FT                   CCVKPWLEAMSQGARHPAPPELSAFATLYPEHALREEREIYPAVVRLSRDRLAEIGQRM
FT                   AQRRGAR"
FT   gene            249771..250070
FT                   /locus_tag="PHG234"
FT   CDS_pept        249771..250070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG234"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Agrobacterium tumefaciens gi:15890598,
FT                   Clostridium acetobutylicum gi:15893369"
FT                   /db_xref="EnsemblGenomes-Gn:PHG234"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85986"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXA3"
FT                   /protein_id="AAP85986.1"
FT                   /translation="MQANSPFLFDARSIAKRFRHAAIFGALEALGEGESMRFVNDHDPL
FT                   PLIEQLRRRYQEQLHIAYVQHADGVVVIDFTVHPAGTAQGCGSGDGTGCGCSGG"
FT   gene            250467..250913
FT                   /locus_tag="PHG235"
FT   CDS_pept        250467..250913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG235"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Burkholderia fungorum gi:22983334,
FT                   Ralstonia solanacearum gi:17548114"
FT                   /db_xref="EnsemblGenomes-Gn:PHG235"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85987"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXA2"
FT                   /protein_id="AAP85987.1"
FT                   /translation="MRLTTMTDYALRLLIYVARHPERMCTNDEIAQAYGISRAHLVKVT
FT                   HKLSRQGWIATVRGRGGGMQLSSGPGSINLGDVVRSVEPDFDLVAGLADGSARKFASDE
FT                   HLCRVMDGARWSFLQYLESFTLADLLGRAFTEPPPADVVHLGRS"
FT   gene            complement(250867..252159)
FT                   /locus_tag="PHG236"
FT   CDS_pept        complement(250867..252159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG236"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative transmembrane protein; similar to
FT                   Magnetospirillum magnetotacticum gi:23014193, Chloroflexus
FT                   aurantiacus gi:22971297"
FT                   /db_xref="EnsemblGenomes-Gn:PHG236"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85988"
FT                   /db_xref="GOA:Q7WXA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXA1"
FT                   /protein_id="AAP85988.1"
FT                   /translation="MDAGAHERQREARHGMVSVVACSIQGRQRKTWPRLAVLLLAVFAL
FT                   LAGMLGGLLRAGVVLPGVDDHHLQWHAHSFHGALMTGGFLGTIIGIERAVALGRLAAFA
FT                   APAASGLGAILMVAGSSAAGAWAMAAGALVFVGVSVAVLRRQPATHTALLLAASVAWLA
FT                   GNVALASGRWVTSVNAWYFIFLVVTVAAERLEMTRLMRRRPSAQAALLAILAGLVLGAA
FT                   GSALEGNAGRIGGVVYGVSLAFLTSWLARFDIARRTVRSHGLSRYIAVCLLLGYGWLLV
FT                   AGAAWAGTAAGLPWRDAALHALGLGFIVSMVMAHAPVILPAITRIKLKFGNSFYVPLAV
FT                   LHLSLAARLSFGHQLPAVKAMAASGNVAAILAFIAVVAAASPGMASQRGAASQAVLSVH
FT                   QAPPPVRGHIAAKGNVFSFCQGALRRQAAAP"
FT   gene            complement(252108..252461)
FT                   /locus_tag="PHG237"
FT   CDS_pept        complement(252108..252461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG237"
FT                   /product="probable hydroxylase"
FT                   /note="similar to Lactococcus lactis subsp. lactis
FT                   gi:15672865, Magnetospirillum magnetotacticum gi:23014194"
FT                   /db_xref="EnsemblGenomes-Gn:PHG237"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85989"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WXA0"
FT                   /protein_id="AAP85989.1"
FT                   /translation="MLSRQASNGTSGFDYQGPEQWLAPITDALRRVVDPELALNVFDVG
FT                   LIYAVTVFEAGVYVSMTMTSTACPLADMVLDDVHLELEGVMPLGYGIEVELCWEPAWTP
FT                   ERMSASAKHAMGW"
FT   gene            complement(252571..253290)
FT                   /gene="nrdG"
FT                   /locus_tag="PHG238"
FT   CDS_pept        complement(252571..253290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="PHG238"
FT                   /product="activase of anaerobic class III ribonucleotide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG238"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85990"
FT                   /db_xref="GOA:Q7WX99"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX99"
FT                   /protein_id="AAP85990.1"
FT                   /translation="MPSPPDACEAAAGRRRDAASLRVGGMTALTTIDFPGRLAAVVFCQ
FT                   GCPWRCGYCHNPGLLDARAPSSIAWADVLAFLQARQGLLDGVVFSGGEPTLQGALAGAI
FT                   ADVQARGFEVALHTAGMYPDRLPAILPQLDWIGLDLKAPLHRYDAITRVPGSGERAWES
FT                   LRHWVASDVAGECRTTWHAGMFDIAELHALAESIAALGVKHWALQECRGSGASASLGRD
FT                   DISRLAARFSSFTLRKA"
FT   gene            complement(253274..253474)
FT                   /locus_tag="PHG239"
FT   CDS_pept        complement(253274..253474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG239"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980091,
FT                   Ralstonia solanacearum gi:17549185"
FT                   /db_xref="EnsemblGenomes-Gn:PHG239"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85991"
FT                   /db_xref="GOA:Q7WX98"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX98"
FT                   /protein_id="AAP85991.1"
FT                   /translation="MIHHDQSAQFTQSLPGHAALRDEERQPCEVWTRVMGYHRPVSSFN
FT                   VGKQGEHRERRFFSEPHAIAT"
FT   gene            complement(253617..255647)
FT                   /gene="nrdD"
FT                   /locus_tag="PHG240"
FT   CDS_pept        complement(253617..255647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="PHG240"
FT                   /product="anaerobic class III ribonucleotide reductase"
FT                   /note="start picked based on SD site"
FT                   /db_xref="EnsemblGenomes-Gn:PHG240"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85992"
FT                   /db_xref="GOA:Q79IN1"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:Q79IN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAP85992.1"
FT                   /translation="MEHCTEAAVASLPREVIKRTGESMAFAIERIQSALRRAGAAAGEF
FT                   GDAQAVSLAGQVARVLAHRYHNQTPGVEQIQDVVEQVLIAANYWNTARAFIAYRGQHAR
FT                   LRQDRKALVDVEASINEYLSKADWRVNANANQGYSLGGLILNVAGKVTANYWLSHVYTP
FT                   EIGEAHRNGDIHIHDLDMLSGYCAGWSLRTLLHEGFNGVPGKVEAGPPKRMSSAVGQIV
FT                   NFLGTLQNEWAGAQAFSSFDTYMAPFVRKDAMSYAQVRQCIQELIYNLNVPSRWGTQTP
FT                   FTNLTFDWTCPEDLREQVPVIGGQEMPFAYGELQKEMDLINRAYIEVMTAGDAKGRVFT
FT                   FPIPTYNITRDFPWESENAKRLFEMTARYGLPYFQNFINSELEPNMVRSMCCRLQLDLR
FT                   ELLKRGNGLFGSAEQTGSVGVVTVNCARLGYLHAGDEAALLRALDRLLELGKQSLENKR
FT                   KLIQHLMDQGLFPYTKRYLGTLRNHFSTLGVNGVNEMIRNFTADRHDITSEWGHAFALR
FT                   LLEHVRERIVAFQQETGHLYNLEATPAEGATYRFAREDRKRWPDIRQAGTAEQPYYTNS
FT                   SQLPVGWTEDPFEALARQEDLQARYTGGTVLHLYMGECLSSGEACRELVRRALTRFRLP
FT                   YITVTPTFSICPTHGYLAGEHPFCPRCDEEILARKRDQLAA"
FT   gene            complement(255789..256712)
FT                   /pseudo
FT                   /locus_tag="PHG241"
FT                   /note="copper type dissimilatory nitrite reductase;
FT                   fragmented gene"
FT   gene            complement(256894..259182)
FT                   /gene="norB"
FT                   /locus_tag="PHG244"
FT   CDS_pept        complement(256894..259182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norB"
FT                   /locus_tag="PHG244"
FT                   /product="nitric oxide reductase qNor type"
FT                   /db_xref="EnsemblGenomes-Gn:PHG244"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85993"
FT                   /db_xref="GOA:Q7WX97"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX97"
FT                   /protein_id="AAP85993.1"
FT                   /translation="MGSYRRLWFLLIAVLAVTFSLLAYYGAEVYRQAPPMPAKVVAADG
FT                   RTLFTGEDILDGQTAWQSVGGMQLGSIWGHGAYQAPDWTADWLHRELTAWLDLAAQDAY
FT                   HKPYDKLDAAARGALREQLRAEYRGNAADPATSVLTVSNRRAQAMAATAGYYDKLFSDA
FT                   PELHTSREHFAMKENTLPSAERRQQLTHFFFWTAWAAATERPGHEATYTNNWPHEPLIG
FT                   NQPTSENVVWSVISVVVLLAGVGFLVWAWAFLRGHEEALPQAPARDPLLSFALTPSQRA
FT                   LGKYLFLVVALFVFQVFLGGFTAHYTVEGQKFYGIDVSQWFPYSLVRTWHIQSALFWIA
FT                   TGFLAAGLFLAPLINGGKDPKYQRLGVDILFWALVVVVVGSFTGNYLAIAQKLPPNLNF
FT                   WLGHQGYEYVDLGRLWQIGKFAGILIWLVLMMRGIAPALRARSGGDKNLLALLTSSVVA
FT                   IGLFYGAGLFYGERTSLTVMEYWRWWVVHLWVEGFFEVFATTALAFIFSTLGLVSRPMA
FT                   TAASLASASLFMLGGIPGTFHHLYFSGTTTPVMAVGAAFSALEVVPLIVLGHEAWDNWR
FT                   LKDRAPWMADLKWPLMCFVAVAFWNMLGAGVFGFMINPPISLYYIQGQNTTPVHAHAAL
FT                   FGVYGFLALGFTLLVLRYVRPAYRLSPGLMKTAFWGLNAGLVLMIGTSLLPVGIIQFLA
FT                   SVEHGTWYARSEEFMQQPILQTLRWVRTFGDVVFIVGAVSFALQVVLGLLGKAPALAAP
FT                   EGRLNAAQR"
FT   gene            complement(259229..259912)
FT                   /gene="norA"
FT                   /locus_tag="PHG245"
FT   CDS_pept        complement(259229..259912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norA"
FT                   /locus_tag="PHG245"
FT                   /product="NorA"
FT                   /db_xref="EnsemblGenomes-Gn:PHG245"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85994"
FT                   /db_xref="GOA:Q7WX96"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX96"
FT                   /protein_id="AAP85994.1"
FT                   /translation="MTLQDQSLGQLARRIPGATRIFHDYSLDFCCGGKHTLREAAQEKG
FT                   LDATAIEARLLALQGGAEPVENDWNTVSPAALIAHIQTRFHDRHREQLPELIRLARRVE
FT                   HVHGDRPDCPLGLADHLAEMQSELEAHMQKEEQVLFPMLARGFHAAAGAPITVMRMEHD
FT                   DHGAALQRLADLTNDITLPRAACNTWRALYLGLRTLREDLMEHIHLENNVLFEPGLPAT
FT                   HGAND"
FT   gene            260063..261607
FT                   /gene="norR"
FT                   /locus_tag="PHG246"
FT   CDS_pept        260063..261607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norR"
FT                   /locus_tag="PHG246"
FT                   /product="sigma 54 dependent transcriptional activator"
FT                   /function="activates transcription of norB"
FT                   /note="Pfam entries PF01590, PF00004, PF00300 and PF00158"
FT                   /db_xref="EnsemblGenomes-Gn:PHG246"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85995"
FT                   /db_xref="GOA:Q9K4V0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9K4V0"
FT                   /protein_id="AAP85995.1"
FT                   /translation="MTPMYPELLTDLVTDLPHAVRLQRLVSGLRTHFRCGAVALLRLEE
FT                   EHLRPVAVDGLVRDTLGRRFAVSLHPRLAAILARRDVTCFHHDSMLPDPYDGLIDEHVG
FT                   EPLPVHDCMGTSLHLDGRPWGVLTLDALTVGTFDAAAQAELQRLTVIVEAAIRTTRLEA
FT                   EIRALQLARGKQPDGEGPADDGEIIGQSQAIAGLLHELEVVADTDLPVLLLGETGVGKE
FT                   LFAHRLHRHSRRRGHPLVHVNCAALPESLAESELFGHARGAFSGATGERPGRFEAAAGG
FT                   TLFLDEVGELPLSIQAKLLRTLQNGEIQRLGSDRPRRVNVRVIAATNRNLREHVRDGSF
FT                   RADLFHRLSVYPIPIPPLRERGNDVLLLAGRFLELNRARLGMRSLRLSAAAQDALRRYR
FT                   WPGNVRELEHVISRAALRCVSRGADRNDIVTLEAELLDLDGLELPAGSAHHAAEAAIAH
FT                   PALPTGATLREAVEQTQRACIEQALRAHDGSWAKAARQLGMDASNLHKLAKRLGSK"
FT   gene            complement(261624..262151)
FT                   /gene="nosL"
FT                   /locus_tag="PHG247"
FT   CDS_pept        complement(261624..262151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosL"
FT                   /locus_tag="PHG247"
FT                   /product="putative lipoprotein"
FT                   /function="nitrous-oxide reductase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG247"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85996"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX94"
FT                   /protein_id="AAP85996.1"
FT                   /translation="MRVNRRQLLLATCALGAQAALSACGQKTGQTVVPAEFNVASTCDL
FT                   DGMLLADYPGPKAQIHFAGESRPTWYCDTAEMFSTLLKPEQVRTVLGVFVQDMELADWD
FT                   RPRGYWFDARTGTYVLGSRRRGSMGPTIASFRQEAAARKFATSFGGQVMRFAEVKPEMV
FT                   DLSGGALHDSRM"
FT   gene            complement(262148..262972)
FT                   /gene="nosY"
FT                   /locus_tag="PHG248"
FT   CDS_pept        complement(262148..262972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosY"
FT                   /locus_tag="PHG248"
FT                   /product="putative transmembrane protein"
FT                   /function="nitrous-oxide reductase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG248"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85997"
FT                   /db_xref="GOA:Q7WX93"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX93"
FT                   /protein_id="AAP85997.1"
FT                   /translation="MADIEWGQIATLAAKEFRDRMRNRWVLAVALVFAVFSLVITYFGG
FT                   AQQGQLGPRSVEYVIASLVSLVTYLIPLIALLLGFDAIVGERERGSLDLLLAMPLTRLE
FT                   LLLGKYLGLAAALALSTLAGFALVAVLLLRQFGWAGLSQYLGFMFSSVLLGLAFLSLAL
FT                   LVSVTGRERTRASGLAIALWFGYVLVFDLLLLGLLVAGGGEFGGAALAYALLLNPADVF
FT                   RILNVFSLDQVRSLYGLAAIVPPALASPWLMGGAMLAWIVMPLALATWRFRQ"
FT   gene            complement(262975..263898)
FT                   /gene="nosF"
FT                   /locus_tag="PHG249"
FT   CDS_pept        complement(262975..263898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosF"
FT                   /locus_tag="PHG249"
FT                   /product="putative copper ATP-binding ABC transporter"
FT                   /function="nitrous-oxide reductase accessory protein"
FT                   /note="Pfam entry PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PHG249"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85998"
FT                   /db_xref="GOA:Q7WX92"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX92"
FT                   /protein_id="AAP85998.1"
FT                   /translation="MTSITPAADGCAIELRDVTRHYGAVRAVDGVDLQVRRGEMFGLIG
FT                   HNGAGKSTLFRMMLGLVPATGGELTVDGACVRSRAFRAARRHIGYLPENLVLYDNLSGL
FT                   ETLRFFARLKRADAGDCQMLLERVGLAAAGKRPVREYSKGMRQRLGFAQALLGSPRVLF
FT                   LDEPSNGLDPAAIRDFYAMLRALREQGVTIVMTSHILAELQERVDRLAIMANGRVRALG
FT                   SVAQLREQNDMPLTLALRVEPDMQPALRERLAAVPVLGWQATGAEIELRCPRTAKMTVL
FT                   SLLAGDVQDLQIREPSLEDLFFGLGG"
FT   gene            complement(263873..265150)
FT                   /gene="nosD"
FT                   /locus_tag="PHG250"
FT   CDS_pept        complement(263873..265150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosD"
FT                   /locus_tag="PHG250"
FT                   /product="putative copper binding periplasmic protein"
FT                   /function="nitrous-oxide reductase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG250"
FT                   /db_xref="EnsemblGenomes-Tr:AAP85999"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX91"
FT                   /protein_id="AAP85999.1"
FT                   /translation="MGALLLASLLMALLVRNVLAETRRVKPGDALQQAIAMAHAGDVLE
FT                   IERGRYDGNFVVDKPLTLRGIGRPTLSGGMHGDTLRITAPDVLVEGLIVRDSGDSLKDQ
FT                   NAGLYIRPGAHRAVVRHCDLTYNLFGLWIEKADDVRIEGNVITGKRDYSSSQRGNGIQL
FT                   YNTRGARIIGNNIGFVRDALYVDVSHHATFRGNRLHHSRYGSHYMNSYHNLWEDNDSYY
FT                   NRGGLALMEVRDQVVRNNRTWGNSDHGIMLRTVQDSVIEGNVVAGNDRGFFIYDVEYAT
FT                   LRSNLVTDNRVGVHLSAGSTRNVVQGNDFIGNREQVRYVGARDEPWGDRAGGPGGNHWS
FT                   NYLGWDRDGDGIGDVPYEANDIVDRLRWRHPGVALLLDSPAVQALRMVGRQFPVLRVPS
FT                   VVDAAPRMNPRHRDWSFWRDKHYPGR"
FT   gene            complement(265177..267798)
FT                   /gene="nosR"
FT                   /locus_tag="PHG251"
FT   CDS_pept        complement(265177..267798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosR"
FT                   /locus_tag="PHG251"
FT                   /product="putative transcription regulator"
FT                   /function="probably involved in transcriptional regulation
FT                   of nitrous oxide reductase; transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:PHG251"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86000"
FT                   /db_xref="GOA:Q7WX90"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX90"
FT                   /protein_id="AAP86000.1"
FT                   /translation="MQPLKHFGAAIVAALFLLLMAGPRPVHAGSAYEAALPPDLRTARN
FT                   LCALVPCQEVFPGAESFSERIGQPPYVEAYGRAGADGKKPKLGYVMLSTDITDTPAYSG
FT                   KPVVTLIGMDTNGRFVGVKVLKHSEPILLLGIPESALLKFNQQYLGKSVADKIEIGASR
FT                   PDEGVLGVDAISGATVTVMAQNQVLTTAGAAVARQVGILAPTRREPARFAPGNPHASWT
FT                   QLAAQGAVQRLRVMPEQVGLARSDDPFIELWFGNLDHPDVGRSLLGEQGYANLRTQLKP
FT                   DEHAIFIIRTAGSESFKGSGFVRGGIYDRVQVKQGADSFTFRDLDYLNLYGLAAEGAPA
FT                   YNESAIFVIRSKAFSSAYPWKLSLLGNRVDRATGARSFTSFDAAYWLPGELLEGGRPEI
FT                   DDPAAPWVRVWKSRAAGIALFAALLVVVTVVYAFRERLTRRATLRNKWPVNAFKYSAWA
FT                   LSIGFVGFGAMAQPSVTQVLTWFHALLFQWTWSLFLSDPFIFLFWIFIILTVFVFGRGL
FT                   FCGWLCPFGSLSEAIHKFGGMIGLRRWQRHLPRAWHDRLKWLKYVIFFGLLAVSMFSMG
FT                   LAEKLAEVEPFKTTFLVGITHRAWPYGLFVCTLLGLSLFVERPYCKYICPLGAALAMPS
FT                   TFRWFGLRRKQDCNSCKACAVGCGSQAIDANGRIDHRECLHCLDCMVLYTDAGGCPPLA
FT                   RERKRRERDGLALTPIGRDGYFIPIQPVAPMPAKVANGPDPRMPTDPVAPLHMAKAVGL
FT                   KRLWLELCDHLWPWSMAGWRSQRALLLAGMSVALAATAAWGLAALGQLSSVAVIAWWFG
FT                   WSTYEVLIRMAGRRYVQDGPWWRNRYRRAGWMDMVSYVGFKNLLIGAALFLTLKAMGLL
FT                   LP"
FT   gene            complement(267860..269791)
FT                   /gene="nosZ"
FT                   /locus_tag="PHG252"
FT   CDS_pept        complement(267860..269791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosZ"
FT                   /locus_tag="PHG252"
FT                   /product="nitrous oxide reductase"
FT                   /function="denitrification, reduction of nitrous oxide"
FT                   /db_xref="EnsemblGenomes-Gn:PHG252"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86001"
FT                   /db_xref="GOA:Q59105"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR023644"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR034205"
FT                   /db_xref="InterPro:IPR041114"
FT                   /db_xref="InterPro:IPR041142"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q59105"
FT                   /protein_id="AAP86001.1"
FT                   /translation="MSKEKASIGNGPGGIGRRQFLGTAALAGLAGVVACTDKGAAPAAA
FT                   AVGAPASGAHGAAHGAGASVHLKPGELDTYYGLWSGGHTGDMRVLGLPSGREILRIPCF
FT                   VPDALVGWGITNESKKVMGARPDGTLRYTVADTHHTHASYKDGNYDGRYAWVNDKINSR
FT                   IARIRLDYFICDKITELPNVQGFHGIFPDKRDPVDTKINYTTRVFCGGEFGIPLPSAPT
FT                   EDAGKYRSLFTCVDAETMAVRWQVLIDGNCDLVATSYDGKLAATNQYNTENGAHFEDMM
FT                   SAERDACVFFNIARIEAAVQAGKFKTYGDSKVPVVDGTQAANKDPKTALTAYVSVPKNP
FT                   HGVNASPDQKYFICAGKLSPTATVIELSRVLGWFDGKQEKLDDAIVAEVELGLGPLHTA
FT                   FDGRGNAYTTLFLDSQLVKWNLDAAIKFHKGDKNAKYVVDRLDLQYQPGHVNASQSETV
FT                   AADGKYLAVGCKFSKDRFLPVGPLHPENEQLIDISGQKMVLMADHPVRGEPHDFIIFKR
FT                   ELVRPKQVYALDDFPLAIKDPKESGVFRNGRKVTVKITSQAPAFSLREFKLKKGDEVTL
FT                   ILTNLDKIEDLTHGFAIPKYNVNFIVNPQETASVTFVADKPGVFWCYCTHFCHALHLEM
FT                   RTRMIVEA"
FT   gene            270003..270401
FT                   /gene="nosC"
FT                   /locus_tag="PHG253"
FT   CDS_pept        270003..270401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosC"
FT                   /locus_tag="PHG253"
FT                   /product="putative cytochrome c-type protein"
FT                   /function="putative electron donor for nitrous-oxide
FT                   reductase NosZ"
FT                   /db_xref="EnsemblGenomes-Gn:PHG253"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86002"
FT                   /db_xref="GOA:Q7WX89"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX89"
FT                   /protein_id="AAP86002.1"
FT                   /translation="MSKRKIVVLGMGIIVQALVACGKQTPAEPAAAAPAPEPAAAVAAA
FT                   APVNELGKSVYGKTCAMCHAAGVAGAPKPGNKDDWGPRIAQGNDTLYKHALEGFTGSKG
FT                   MMPARGGSTSLQDGDVKAAVDFMVAQSH"
FT   gene            270411..271439
FT                   /gene="nosX"
FT                   /locus_tag="PHG254"
FT   CDS_pept        270411..271439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosX"
FT                   /locus_tag="PHG254"
FT                   /product="NosX"
FT                   /function="nitrous-oxide reductase accessory protein"
FT                   /note="similar to AbpE thiamine biosynthesis proteins;
FT                   FrameD picked start at codon 46, start picked further
FT                   upstream based on BLASTP"
FT                   /db_xref="EnsemblGenomes-Gn:PHG254"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86003"
FT                   /db_xref="GOA:Q7WX88"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX88"
FT                   /protein_id="AAP86003.1"
FT                   /translation="MNASRPDRPNPGRRRLLCAWPLLATGLWIRPALADPRVAQSSRTL
FT                   MGTRVDITVQARHADTAAPAMAAAWAEMARLADLMSRYRVGSQVHALQLAAGVQPVKVA
FT                   PEMLRVLGMANRMSRRSAGAFDITVGAFAGWNFDPAHPAMPDQAEIARELPLVNYRDVV
FT                   VDPRAETAFLRRQGMRIDLGGIAKLPVLQAGMDVLRQHGLDGAMINGGGDVLVSGALQG
FT                   RAWRIGVRDPLAPARLTGVIAMHDGLVAASGDYERCFMQAGRRYHHILDPGTGMPSAGP
FT                   HGVTLVARGVDDINGLGAAIMVAGETAGRHWLEALPGVDAMIVGPGGRRWLSAGMAGRL
FT                   IG"
FT   gene            complement(271518..271961)
FT                   /locus_tag="PHG255"
FT   CDS_pept        complement(271518..271961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG255"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22975508,
FT                   Ralstonia solanacearum gi:17549189"
FT                   /db_xref="EnsemblGenomes-Gn:PHG255"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86004"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX87"
FT                   /protein_id="AAP86004.1"
FT                   /translation="MSVLQTLMAGVHRRMPARACALPLVAALEIARRAGWLEPPAALDG
FT                   HSFLLTVEDLGLDVPFRCEGGRFHTGRSDGSAPALTLRARAVDYLRLLGGEADTDTLFF
FT                   QRKLVISGDTALGLEVKYWLDAAPRPAWVGDVVSRMLGRAVPG"
FT   gene            complement(271958..272899)
FT                   /locus_tag="PHG256"
FT   CDS_pept        complement(271958..272899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG256"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22975507,
FT                   Ralstonia solanacearum gi:17549190"
FT                   /db_xref="EnsemblGenomes-Gn:PHG256"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86005"
FT                   /db_xref="GOA:Q7WX86"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX86"
FT                   /protein_id="AAP86005.1"
FT                   /translation="MGAPMSETFVPAQQAANVPRFGIALGPLLYYWPRETVMQFYAAAA
FT                   DSAVDRVYLGETVCTRRHELRHAHWLEIATMLREAGKEVVLSTPVLIESDTDIAWMRRV
FT                   CEQDDYLVEANDLGAVRCMGGRPFVGGPHLNVYHADTLAWLAGLGARGCAVPVEMDGPT
FT                   LCRLAAGRPRGVSLEAMVWGRMPLAFSARCFTARHHRLRKDSCEFRCLDYPDGLVAATG
FT                   EGQPFFTLNGVQTQSATCLDLCGEAVSMAAMGVDMLRVSPHASGTLDVVATLAAIRAGE
FT                   RPAAPTGITPAGAQPCNGYWHGAAGIVWEERT"
FT   gene            complement(272942..273988)
FT                   /locus_tag="PHG257"
FT   CDS_pept        complement(272942..273988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG257"
FT                   /product="probable protease"
FT                   /note="similar to Ralstonia metallidurans gi:22975506,
FT                   Ralstonia solanacearum gi:17549191; Pfam entry PF01136"
FT                   /db_xref="EnsemblGenomes-Gn:PHG257"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86006"
FT                   /db_xref="GOA:Q7WX85"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX85"
FT                   /protein_id="AAP86006.1"
FT                   /translation="MKFSSPESPAEPQPPRRPQLVAPAGSLAALRMALQHGADAVYLGL
FT                   RDATNARNFGGLNFTEADIRTGVAEAHARGAEVLFAINTFAQMGAVGQWHRAVDAAADL
FT                   GADAVIMADAGLMGYASQRHPDLRLHLSVQGSATHADAIELMRERFNIRRVVLPRVLSL
FT                   AQIGKLARQTSVELEVFGFGSLCVMAEGRCLLSSYATGDSPNNKGVCSPAHAVRWTEQD
FT                   GTLHARLSGILIDSYAPGEPAGYPTLCKGRFEVEGERGYVLEEPTSLNALSLLPSLIDM
FT                   GIAAIKIEGRQRSPRYVGDVVGVLRAAIDAACADPARFAPRQEWQSTLGRHAEGDQVTQ
FT                   GAYDRPWR"
FT   gene            274238..275416
FT                   /locus_tag="PHG258"
FT   CDS_pept        274238..275416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG258"
FT                   /product="putative 2-nitropropane dioxygenase"
FT                   /note="similar to Ralstonia metallidurans gi:22978238,
FT                   Ralstonia solanacearum gi:17544833; FrameD picked start 5
FT                   codons further upstream, start picked based on ribosome
FT                   binding site; Pfam entry PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:PHG258"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86007"
FT                   /db_xref="GOA:Q7WX84"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX84"
FT                   /protein_id="AAP86007.1"
FT                   /translation="MKEHWLKLAGRRLVPVVQGGMGIGISAHRLAGTVAGLNGMGTIAS
FT                   IDLRHHHPDLLAQTRGTRDKPRIEAANLVALDREIKAARALSGGRGMIAVNVMKAVGSH
FT                   AALVRQSCESGADAIVMGAGLPLDLPELTANYPKVALIPILSESRGIGLVLRKWMKKGR
FT                   LPDAIVIEHPNHAGGHLGAPAIQELGEARFSFSRVLAECRELFASLGLAWESIPLILAG
FT                   GIDSHAKVRHWIGQGAAAVQLGTAFAVTEECDAHPAFKQVLATARPESLREFTSVAGLP
FT                   ARAVLTPWLSRYLSSEAKLQRRAKVRECLEGFDCLQSCGLRDGIARIGQFCIDLKLSQA
FT                   VRGDVERGLFFRGKGALPFGEAIRPVAELMHYLLTGEKPAALAATSAPAMAA"
FT   gene            275593..276042
FT                   /locus_tag="PHG259"
FT   CDS_pept        275593..276042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG259"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia solanacearum gi:17549188,
FT                   Klebsiella pneumoniae gi:03758876"
FT                   /db_xref="EnsemblGenomes-Gn:PHG259"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86008"
FT                   /db_xref="InterPro:IPR014958"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX83"
FT                   /protein_id="AAP86008.1"
FT                   /translation="MSKSDTTSLPLVYACSGCSSVAQLANTVAVRLDRGGLAEMSCISG
FT                   VGGGVPALTRVARSGRPILALDGCPLACVKACLASAGVAPAQHLVLNRLGATKRQHGEC
FT                   SEAEAGAVWAAVTLALSAIKDAPPQLADKSAALVKANGTLRHRLQ"
FT   gene            276130..276222
FT                   /locus_tag="PHG260"
FT   CDS_pept        276130..276222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG260"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86009"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX82"
FT                   /protein_id="AAP86009.1"
FT                   /translation="MAELMHHLLTGETPAALTVAPAGSSGLRQP"
FT   gene            276258..277046
FT                   /locus_tag="PHG261"
FT   CDS_pept        276258..277046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG261"
FT                   /product="putative enoyl-(ACP) reductase"
FT                   /note="similar to Burkholderia fungorum gi:22982236,
FT                   Ralstonia metallidurans gi:22975990"
FT                   /db_xref="EnsemblGenomes-Gn:PHG261"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86010"
FT                   /db_xref="GOA:Q7WX81"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX81"
FT                   /protein_id="AAP86010.1"
FT                   /translation="MGILSGKRILITGMLSNRSIAFGIATACRRQGAELAFTYADERVA
FT                   ARVRELAADFSSELVFPCDVASDTQIDAALASLRAHWSQLDGLVHAIGYAPREALSGGF
FT                   LDGLSRDSFRIAHDISAYSFPALASAALPMLAPRAVLLTLSYLGAQRTLPHYNVMGLAK
FT                   ASLEASVRYLAAALGGRGVRVNAISAGPLRTLAAAGIRDFGKILEHVANTAALRRNIDS
FT                   EEVGNVAAFLLSDLASGMTGQVSYVDAGYRCMAAPLDLAD"
FT   gene            complement(277086..277772)
FT                   /gene="dnrD"
FT                   /locus_tag="PHG262"
FT   CDS_pept        complement(277086..277772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnrD"
FT                   /locus_tag="PHG262"
FT                   /product="transcriptional regulator"
FT                   /note="Dnr/Nnr subgroup of Fnr like transcriptional
FT                   regulators, similar to Ralstonia solanacearum gi:17549187,
FT                   Pseudomonas stutzeri gi:04585799"
FT                   /db_xref="EnsemblGenomes-Gn:PHG262"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86011"
FT                   /db_xref="GOA:Q7WX80"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX80"
FT                   /protein_id="AAP86011.1"
FT                   /translation="MADPIPFARMPLFRGIDAEVLDALRQAATPQHLRKGEFLFRRGEA
FT                   CQGLYVVVEGLVKLALPTAPASERTLERAIEVFGPGAIFGEDALFLDAPQVADCQAQAR
FT                   TTVLHVSKLALWGAVERDPLVSTQLLRNLSGRLHTLMRDIEAVSLQNALQRVASFLHEQ
FT                   AQAGRRTWLACTQRVIASKLGVTPETLSRVMSRFSAQKLVKLERGKIFLLDAEGLARQV
FT                   AASNER"
FT   gene            complement(277765..279102)
FT                   /locus_tag="PHG263"
FT   CDS_pept        complement(277765..279102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG263"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative transmembrane protein, similar to Ralstonia
FT                   metallidurans gi:22978237, Ralstonia solanacearum
FT                   gi:17549192"
FT                   /db_xref="EnsemblGenomes-Gn:PHG263"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86012"
FT                   /db_xref="GOA:Q7WX79"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX79"
FT                   /protein_id="AAP86012.1"
FT                   /translation="MKAANLDYERAPPPGVVFGCLMPAPWLGAAAGLLLAFGSVDGLPD
FT                   RFAPLALAAVHVLALGMLLPVMLGALFQMMPVVAGVTVPGAGWMAPLVALSGGGSALAL
FT                   SAGFLGGSAAAFRWAALLGAPFLVLAGLLLLGAGRRVAAVDATTRTLAWIGAPLLLTAL
FT                   CGGVLAGLFGGLWPASPAPLLALHIAWGLGGWLAALVTGVATTVLPMFWQTSRLPARLE
FT                   RWLPLAHWVPLLAFTVAVVAWPRSTALSQWTLLPWLVVAAVVAGFGLAGTLKAKRRHDP
FT                   VWPLWPVACASMLAAALLAAAMPFVPDSRAPLAWWIGSLALIGGGVLPVTAMLGKIVPF
FT                   LVWLHLRKLLPPRARVPAMQAIIAPGRQRRQAMLLLAAYLMLLALPVAPAWLAPAGGLA
FT                   FAAANLWLGVQLLTALRCMRRMRAQGGLPPRVPRPATLPVEGGRDG"
FT   gene            complement(279146..279571)
FT                   /locus_tag="PHG264"
FT   CDS_pept        complement(279146..279571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG264"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22978236,
FT                   Aquifex aeolicus gi:15606247"
FT                   /db_xref="EnsemblGenomes-Gn:PHG264"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86013"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX78"
FT                   /protein_id="AAP86013.1"
FT                   /translation="MSTGIETLVQQHRGCDDALGQLETALRGGDWDLIAGALARLEAEL
FT                   SGNFEAEESRLFPAFERAIGFAGGPTSVMRHEHEEVRVLLDNAREWLELRDGNALAAEI
FT                   DTLVVLLQQHNVKEENVLFPMCRAQVPDLDAVLAGIA"
FT   gene            279984..281972
FT                   /gene="narX"
FT                   /locus_tag="PHG265"
FT   CDS_pept        279984..281972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narX"
FT                   /locus_tag="PHG265"
FT                   /product="transmembrane nitrate/nitrite sensor kinase"
FT                   /note="NarX/NarL two component system; Pfam entries PF03059
FT                   and PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:PHG265"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86014"
FT                   /db_xref="GOA:Q7WX77"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR042295"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX77"
FT                   /protein_id="AAP86014.1"
FT                   /translation="MPDSGADLATLPALRHRLSTRIISLSLASLLVVLAMIAGTLWLSW
FT                   KLEGAGAAINDAGSLRMRANRVAIELTLSQAGKPNALDDQIAALDNTLAQLRKGNPARP
FT                   LFLPDEPAIHAQLDRVVDGWQHRLKPLARAGGLMAGQATTAYIDALPSFVTQADRLVGM
FT                   IEHVSASKTDLLRVSQAGLAAMACVGTVAVIYLLYLWIILPVLRLQDGLRRMAAREFSL
FT                   RLPVETRDEFGTLNEGFNRMASELQDLYRDLEARVAQKTAELAHQNRDLETLYEMAAFL
FT                   NQATDAEAMCNGFLQRVMRQFDADGGSVRAFDDVRGKLPLMTSIGLPAALSGAAQCVSV
FT                   KACHCGDATTQSVIAIQDLRHAPARAAGPVSPSPCTRNGFQALAAFRIGSLRGATGVFA
FT                   LHFREPRELPPSDRQLLETLGRHLGTALEQLRLSDSARQLAVVEERNLVAQGLHDSIAQ
FT                   GLNFLNLQVQLLADAVGRDDLPEAREIVPMLRHGVEESYQDVRELLNNFRSRLTPGELR
FT                   PAVEATVERFRRQCRTEATLIVDDGGDVLPLHPEQQLQVLFILQEALSNVRKHALAAHV
FT                   TVRLSHGRDFRLVVHDDGEGFDPADLAQRSDAHIGLNIMRERAARLNARLQIDSQPGAG
FT                   VRIALLLPRGEQQPDAMAASQLQNTFP"
FT   gene            281969..282631
FT                   /gene="narL"
FT                   /locus_tag="PHG266"
FT   CDS_pept        281969..282631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narL"
FT                   /locus_tag="PHG266"
FT                   /product="nitrate/nitrite response regulator"
FT                   /note="NarX/NarL two component system; Pfam entries PF00196
FT                   and PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:PHG266"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86015"
FT                   /db_xref="GOA:Q7WX76"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX76"
FT                   /protein_id="AAP86015.1"
FT                   /translation="MTICILLIDDHTLFRSGIRALLQRQADFEIVDEAADGVEDIKRAK
FT                   QRRPDVILLDLNMPGLSGLEALQLLVEDLPDSAVIVLTVSEEAEELAIALRSGARGYLL
FT                   KNIETEALTSAIRRAAAGEPVISESMTAKLVAQFRAPAPAAVAVPQQVDTARLTVRERE
FT                   IVQELARGESNKEIARTLGVAASTVKIHVQNILKKLNLASRVQVAVYAVEHRLTETG"
FT   gene            complement(282997..284217)
FT                   /locus_tag="PHG267"
FT   CDS_pept        complement(282997..284217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG267"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative transmembrane protein, similar to Ralstonia
FT                   solanacearum gi:17548116, Ralstonia metallidurans
FT                   gi:22977478"
FT                   /db_xref="EnsemblGenomes-Gn:PHG267"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86016"
FT                   /db_xref="GOA:Q7WX75"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX75"
FT                   /protein_id="AAP86016.1"
FT                   /translation="METIPILPARGPRKSPEAGPPPRGFALFALGFRPFYLGGAIFSAV
FT                   AIALWAAMLAGITSVGSSASLPPMLWHAHEMVFGFAVAIVIGFLFTAGRAWTGQPTPTG
FT                   PLLACLFLLWLAGRIAMWTASGEAALVIDGAFLPLAALAFTRALVKGGSRRNYPLALAL
FT                   WLLAAANIVSLWLQSQGQTDGALRACQAGVALISLFVIVIGGRVIPMFTTNAIPGFRLR
FT                   QYRNVDRAVVPAGVLGLAAGLLPLPGWLGAVLSLLAAFVLGIRVWGWRGHAVGNRPLLW
FT                   VLHLAYAWLPLAFVLQAGAVLGLWMPGIATHAFTVGVLGGAIIAMITRTALGHTGRMLV
FT                   AGRAETIAYWLVAAAALLRVLGPLLWPAGYRHWLYGAALCWVAGFGLYALTYAPRLMRP
FT                   RVDGKPG"
FT   gene            284442..285722
FT                   /gene="narK1"
FT                   /locus_tag="PHG268"
FT   CDS_pept        284442..285722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narK1"
FT                   /locus_tag="PHG268"
FT                   /product="putative nitrite/nitrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PHG268"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86017"
FT                   /db_xref="GOA:Q7WX74"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX74"
FT                   /protein_id="AAP86017.1"
FT                   /translation="MATPHPARAPIPPGAYTTLASSTFAFTICFAVWMLFAVLGIPLKK
FT                   ELGLNDTEFGLLAATPVLSGSLIRVPLGLWTDRYGGRIVFFVLMLATVIPIWLISYAHS
FT                   LWQLLVLGLFVGLAGGSFSVGTPYVARWFPRSRQGLAMGIFGAGNSGAALTKFVAPAMI
FT                   LAAGTWEIVPRVYSLAMLATALVFWVFSRSNPAHLVKSSTGWREQLSMLRDPRVWRYSQ
FT                   YYSVVFGGYVGLSLWMTKYYIGEYGFDIKTAAFLAACFSLPGGALRAIGGWISDRYGAH
FT                   RTTWWVMWVSWVGFFLLSYPQTDFIVQTTSGPQGFRIALTPTVFTLLLFVVGIAFAIGK
FT                   ASVFKFISNDFNHNIGAVSGVVGLAGGLGGFVLPILFGMLADLTGIRSSCFMLMYGTVC
FT                   VSLVWMHYSHRTERQRKEQAVGLTQPA"
FT   gene            285762..287156
FT                   /gene="narK2"
FT                   /locus_tag="PHG269"
FT   CDS_pept        285762..287156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narK2"
FT                   /locus_tag="PHG269"
FT                   /product="putative nitrite/nitrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PHG269"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86018"
FT                   /db_xref="GOA:Q7WX73"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX73"
FT                   /protein_id="AAP86018.1"
FT                   /translation="MSTSVLTRWEPENAAFWQSKGERIAYRNLGISIPALMLAFVVWML
FT                   WSVVAVNLDRAGFQFTKNQLFWLTALPALSGATLRIFYSFLVPVFGGRRFTAISTALLL
FT                   IPALGMGFALRDPSTGYPTLLVLALLCGLGGANFSSSMANISFFFPKAKKGLATGLNAG
FT                   IGNLGVSVVQFVTPLVVSVAIFGALGGEPQQFPANEANGTTQSLWLQNAGFIWVPFIVV
FT                   SALAAWFGMHDIADAKASFAEQAVIFKRKHNWLMCWLYVGTFGSFIGFSAGLALLTKSQ
FT                   FPGVNPTAYAFLGPLVGALTRPVGGWISDKLGGARVTLWTFAGMIAAVFAVLAALPHDG
FT                   AGGNFMYFLAAFVALFALTGIGNGSTFRMIPVIFLTERQRAAAGKGDVAQKQALQEAGK
FT                   ESAAVLGFSGAIGAYGGFFIPKSFGTSLELTGAADAALYCFIAFYLSCVLVTWWHYARR
FT                   NAPMPC"
FT   gene            287344..291105
FT                   /gene="narG"
FT                   /locus_tag="PHG270"
FT   CDS_pept        287344..291105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narG"
FT                   /locus_tag="PHG270"
FT                   /product="respiratory nitrate reductase catalytic subunit"
FT                   /note="Pfam entries PF00384 and PF01568"
FT                   /db_xref="EnsemblGenomes-Gn:PHG270"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86019"
FT                   /db_xref="GOA:Q7WX72"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR028189"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX72"
FT                   /protein_id="AAP86019.1"
FT                   /translation="MSHFLDRLKFMSRVKSTYADGHGAVVNEDRKWEDGYRSRWQHDKI
FT                   VRSTHGVNCTGSCSWKVYVKNGLITWETQQTDYPRTRPDLPNHEPRGCPRGASYSWYVY
FT                   SAQRVKYPMIRGRLMEMWREARKTMDPVAAWESVSQDPVKAARYKSVRGLGGFVRADWN
FT                   TATEMIAAANAFTVKKFGPDRVIGFSPIPAMSMVSYAAGARYLSLLGGACLSFYDWYCD
FT                   LPPASPQVWGEQTDVPESADWYNSTYLMVWGSNVPQTRTPDAHFYTEVRYKGTKTVAVS
FT                   SDFGEMVKFGDIWLAPKQGTDAALAMAMGHVVLKEFHASGKSAYFRDYVKQYTDMPMLV
FT                   LLRKNDDHQGTLVPDHFLRASHLANNLGEANHPEWKTLQIDDATGEIVAPNGSIGFRWG
FT                   EGAHNGGEKVGRWNLEMKDGGSGRTVDPRLSLVSYADEVVEVGFPYFGGEHDELLRRRV
FT                   PARRLTLADGSTALVATVYDLQMANYGVDQGLGGPNVAASYEDDVPYTPAWQEKHTSVP
FT                   ARLVTQVAREFADNADRTQGKSMVIVGAALNHWYHNDMIYRGIINLLMMCGCIGKSGGG
FT                   WAHYVGQEKLRPQFGWAPLAFGLDWSRPPRQMNGTSFFYNHTSQWRHEKLGVDEILSPT
FT                   ADRKRYDGLSLLDLNARSERMGWLPSAPQLGANPLDVVDAAERNGQDPVAYTVEQLKSG
FT                   KLQFACDDPDNPANFPRNMFVWRSNILGSSGKGHEYFLKYLLGTQNAVFGDENDAITPS
FT                   EVNVRPAAEGKLDLLTVLDFRMSTTCLYGDIVLPTATWYEKDDLNTSDMHPFIHPLSEA
FT                   VQPLWESKTDWEIYKAIAKKFSEIAGPYLGTRKDLVCTPLLHDTPGELGQPFEPKDWKA
FT                   GECDLIPGKTAPSMTVVERNYADLYKKFTSIGPLLDKLGNGGKGINWNTQHEVKEIGQL
FT                   SHTVQEPGVSQGRPKLETAIDAAEMILTFAPETNGHVAVKAWEALSKITGRNHTHLAEG
FT                   REHDKIRFRDVQAQPRKIISAPTWSGLESEEVSYNAGYTNVHELIPWRTLTGRQQFWQD
FT                   HRWMLDFGEGACVYKPAIDTKTVAPMLGKKPNGNPELVLNWITPHQKWGIHSTYSDNLR
FT                   MLTLSRGGPHVWISETEAKANGIRDNDWVEVFNVNGTLTARVVVSQRVPKGMCLMYHAQ
FT                   EKIVNVPGAETSGMRGGIHNSVTRAVTKPTHMIGGYAQLAYGFNYYGTVGSNRDEFVIL
FT                   RKMKKVDWLEGPLVEKTAKLTVNEGASQ"
FT   gene            291102..292652
FT                   /gene="narH"
FT                   /locus_tag="PHG271"
FT   CDS_pept        291102..292652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narH"
FT                   /locus_tag="PHG271"
FT                   /product="respiratory nitrate reductase subunit"
FT                   /note="Pfam entry PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:PHG271"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86020"
FT                   /db_xref="GOA:Q7WX71"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX71"
FT                   /protein_id="AAP86020.1"
FT                   /translation="MKIRAQVAMVLNLDKCIGCHTCSVTCKNVWTSRDGVEYAWFNNVE
FT                   TKPGIGYPKEWENQDKWQGGWKRNADGTLEPRQGGKLKILANLFANPNLPAIDEYYEPF
FT                   TYDYEHLQKAPLVQTPPTARPVSVLTGRKMEKIEWGPNWEDDLGGEFSSRGRDKLFDNV
FT                   QKEMYSTFENTFMMYLPRLCEHCLNPACVASCPSGSIYKREDDGIVLVDQDKCRGWRMC
FT                   ISGCPYKKIYFNWQSGKAEKCLFCYPRIEAGQPTVCSETCVGRIRYLGVMLYDADRIEQ
FT                   AASVADERDLYQSQLDVFLDPHDPAVQAEALRQGIPQSWLDAARKSPVYKMACEWKVAF
FT                   PLHPEYRTLPMVWYIPPLSPIQSAAEAGHMGLNGVIPDVKSLRIPVRYLANLLTAGDVM
FT                   PVLSALDRMLAMRAYKRSQVVDGVQDLGVLEQVGLTPAQVEDMYQTMAIANYEDRFVIP
FT                   SSHKEMVEDSFNDKASCGFTFGNGCSGGTSEGALFGKKPQGSVHFVDMPKSRKKAVMS"
FT   gene            292690..293364
FT                   /gene="narJ"
FT                   /locus_tag="PHG272"
FT   CDS_pept        292690..293364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narJ"
FT                   /locus_tag="PHG272"
FT                   /product="respiratory nitrate reductase subunit"
FT                   /note="Pfam entry PF02613"
FT                   /db_xref="EnsemblGenomes-Gn:PHG272"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86021"
FT                   /db_xref="GOA:Q7WX70"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX70"
FT                   /protein_id="AAP86021.1"
FT                   /translation="MPLYPILSALFGYPEQDLLDALPEIDAALAEWPQVRDLLAPVTDL
FT                   LRSESLIALQENYVATFDRNPAHSLHLFEHVHGESRDRGQAMVDLIDEYRREGFEPAAS
FT                   ELPDYVPLFLEFLGALVADGKEARAEQLLGEAIHVLAAIGERLARNQSPYAGVFAVLRT
FT                   LTDVQPQPQQEPPVRDMDEALETFGPGADGVEPLLAPQAGPQAVKFYPRDPRAKAPVPA
FT                   AC"
FT   gene            293413..294096
FT                   /gene="narI"
FT                   /locus_tag="PHG273"
FT   CDS_pept        293413..294096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narI"
FT                   /locus_tag="PHG273"
FT                   /product="respiratory nitrate reductase transmembrane
FT                   subunit"
FT                   /note="Pfam entry PF02665"
FT                   /db_xref="EnsemblGenomes-Gn:PHG273"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86022"
FT                   /db_xref="GOA:Q7WX69"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX69"
FT                   /protein_id="AAP86022.1"
FT                   /translation="MATLHQFLFGIYPYIAAAIFLFGSLARFEREQYTWKTDSSQVLYR
FT                   GNLRTGNILFHVGILGLFFGHLVGLLTPVAVWDALGVSHGFKQGVAMAAGGVMGTMCLA
FT                   GLLILLHRRLTNARVSAVTRTGDKVLLLWLLVTLLLGLSTIFESASHMDGHMMVQLMTW
FT                   AQHIVTLRGDAASYVADAPLLFKAHLFMGITLFAIFPFTRLVHVWSGFASVGYLGRAWQ
FT                   LVRSR"
FT   gene            294124..294876
FT                   /locus_tag="PHG274"
FT   CDS_pept        294124..294876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG274"
FT                   /product="probable peptidyl-prolyl cis-trans isomerase"
FT                   /note="similar to Brucella melitensis gi:17989299, Brucella
FT                   suis 1330 gi:23500050; Pfam entry PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:PHG274"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86023"
FT                   /db_xref="GOA:Q7WX68"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX68"
FT                   /protein_id="AAP86023.1"
FT                   /translation="MPVTVNGVELRDADIERELDHHHDAANPARLATIAAILRQLVRTE
FT                   ADRIGLAAEGLDDDALALALLEREAGIPEPDEASCRRHYDSRPERFRDGEWVEADHILF
FT                   QVTPRVPLDALREIAAQTLALVRGDPSTFAEHARALSNCPSGVNGGRLGRVFRGETAPE
FT                   FERALFGALQDGVLPQLVETRFGLHIVRILERYPGTRLPFDAVRGDIARALAAAARDRA
FT                   WKQYASLLIGRARIDGIELEGADSPLVQ"
FT   gene            295014..295577
FT                   /gene="mobB"
FT                   /locus_tag="PHG275"
FT   CDS_pept        295014..295577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="PHG275"
FT                   /product="putative molybdopterin cofactor biosysnthesis
FT                   protein"
FT                   /note="similar to Ralstonia solanacearum gi:17549199,
FT                   Bradyrhizobium japonicum gi:27377422"
FT                   /db_xref="EnsemblGenomes-Gn:PHG275"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86024"
FT                   /db_xref="GOA:Q7WX67"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX67"
FT                   /protein_id="AAP86024.1"
FT                   /translation="MQEFVVGITGTSGSGKTTLITAMLPWFRERGLRVNVVKHSHHPLE
FT                   LEPPAKDSARFRAAGASEVMVASPYRFAIVHELRGDAEPTLAEQLARLAPAELTLVEGF
FT                   RSDAIPRIEVYRPVHGREPYYPCDPSIVALATDRNTDAALPCLPLNHPPEVAQFILALR
FT                   ERHTGKRMLHPAAHRHGFRAPDAS"
FT   gene            complement(296198..296959)
FT                   /gene="fnr"
FT                   /locus_tag="PHG276"
FT   CDS_pept        complement(296198..296959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fnr"
FT                   /locus_tag="PHG276"
FT                   /product="transcriptional regulator"
FT                   /note="FrameD prediction picked ORF start at codon 52; ATG
FT                   picked further upstream based on BLASTP"
FT                   /db_xref="EnsemblGenomes-Gn:PHG276"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86025"
FT                   /db_xref="GOA:Q7WX66"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAP86025.1"
FT                   /translation="MIVSRDQSCRFQLLPSVPITEMSPRCSTCTMGQLCLPMGMSQQDL
FT                   ARMDTLVQERIRVQKGETLYRMGDPLAAVYAVRFGTLKTHVTTEDGRSQITGFYLPGEI
FT                   VGLDGLGEMQHASDAAALEDTEVCVVRLNDLQSLSADLPSLQHQFLRLMGKEITRDQLM
FT                   LVMLGAMRAEERLAAFLINLSERLSARGYSASEFVMRMSREEIGSYLGLKLETVSRLFS
FT                   RFAEAGLIQIRQRHVKLVDIAGIKELYSRSC"
FT   misc_feature    complement(296806)
FT                   /gene="fnr"
FT                   /locus_tag="PHG276"
FT                   /note="alternate site of translation initiation"
FT   gene            complement(296989..297459)
FT                   /locus_tag="PHG277"
FT   CDS_pept        complement(296989..297459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG277"
FT                   /product="putative integrase"
FT                   /note="similar to N-terminus of Rhizobium sp. NGR234
FT                   gi:02497415, Mesorhizobium loti gi:13488149"
FT                   /db_xref="EnsemblGenomes-Gn:PHG277"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86026"
FT                   /db_xref="GOA:Q7WX65"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX65"
FT                   /protein_id="AAP86026.1"
FT                   /translation="MTPLRERMLADMQIDNTQKSYLLQVFSFAPHFRRSPELLGPEEIR
FT                   AWRVYLREERKLAPSSLCPAIGALRFLYRVMLRRDWSDEDFPLPKKPVRLPVILSQDEI
FT                   TAFFASVASLKQRTILMTTSLPARYRHTWAAQCIPLSKASQKMQKSTEIFIF"
FT   gene            complement(297650..299743)
FT                   /locus_tag="PHG278"
FT   CDS_pept        complement(297650..299743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG278"
FT                   /product="putative sensor kinase"
FT                   /note="similar to Nostoc punctiforme gi:23125941; Pfam
FT                   entries PF00672, PF00989 and PF00211"
FT                   /db_xref="EnsemblGenomes-Gn:PHG278"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86027"
FT                   /db_xref="GOA:Q7WX64"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX64"
FT                   /protein_id="AAP86027.1"
FT                   /translation="MRVLLLVLLAILPMLLLILATNLEERHAAEKRVQEDTVRLLHLTI
FT                   SQHERFIEGSRQLLIALAQIPVVHDRSEAACSTLFGNFLKQYPFYANLGAADLEGNVYC
FT                   SGLRLAEPVNLADRGYFQRALQYKGLAIGDYQIGRITGKASVNFGYPILDETGSPKGVV
FT                   YAALDLRWLEQLAVEARLPPDAVLIVLDRHGTVLFEHPDWRRWMGVAAAGNPLVEAILS
FT                   HQEEGTVELPNLEGVTSLFAFAPLRSARGVVITTQGYLAVGIPTSVAFAQVNRAFAYRL
FT                   LFFSAVALLALATAWWFGAVFILRPARALLAATERLEEGDLQARTGLLPGHGELSQLAG
FT                   SFDRMAERLQEHQAQLRHALTETTELKDLLDNVFASIVSGVITTDLQGKIMLCNLAALP
FT                   ILGYREAEELVGRNIVELQPPLGLALLSHVLSTARTDKPVIGLELAPTVTGRGTVYLRF
FT                   NLSTLKGLQQPQGIAIVLDDVTEKRLMEAQQQLLKHMVSPAILAQIDTEHLQPAGKRTE
FT                   ITTLFADIHGFTGISEQLNPDDLFGLLNRYLGVMTDAVLAQEGTIDKFLGDAVMAWFNA
FT                   PIPQPDHVMRALRTALGIREAIQALYQQISPLFHLSVGIGLHVGEAVLGLVGGKQRMEY
FT                   TAIGDDVNIAKRIQEHAGIDQILISAAVYARVQDQVIVRPVTVIQVKGRQKPLEVYELL
FT                   GLK"
FT   gene            complement(300811..301011)
FT                   /locus_tag="PHG279"
FT   CDS_pept        complement(300811..301011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG279"
FT                   /product="putative invertase"
FT                   /note="similar to Rhodospirillum rubrum gi:02346994,
FT                   Shewanella oneidensis mr-1 gi:24376250"
FT                   /db_xref="EnsemblGenomes-Gn:PHG279"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86028"
FT                   /db_xref="GOA:Q7WX63"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX63"
FT                   /protein_id="AAP86028.1"
FT                   /translation="MSENRLGRKGGRKPKMTDSKIESAKALLASGVPPKDVAKNLACPF
FT                   LRSTAACRPPRTLNLRFFPVS"
FT   gene            complement(301008..301304)
FT                   /locus_tag="PHG280"
FT   CDS_pept        complement(301008..301304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG280"
FT                   /product="putative nucleotidyl-transferase"
FT                   /note="similar to Nitrosomonas europaea gi:22955015,
FT                   Shewanella oneidensis mr-1 gi:24376248; Pfam entry PF01909"
FT                   /db_xref="EnsemblGenomes-Gn:PHG280"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86029"
FT                   /db_xref="GOA:Q7WX62"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX62"
FT                   /protein_id="AAP86029.1"
FT                   /translation="MPMRPSVVLDLKRSAIREAASRFRTANLRVFGSVLHGTDRDGSDL
FT                   DLLVDALPGATLFDLGGLQDELETLLGVHVDLLTPADLPPKFRMKVLAEARPV"
FT   gene            301471..301983
FT                   /locus_tag="PHG281"
FT   CDS_pept        301471..301983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG281"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86030"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX61"
FT                   /protein_id="AAP86030.1"
FT                   /translation="MRTLEDPTSTRFADHDTLRCARGEIADEVEPAARRVFGAQGSAWL
FT                   APIWRTLARAAEHLPLCRDEDETHAAPLWLKAGDWVATQDAVARIESRRRIPPALSWMA
FT                   EAQYHQQGLEAVWPLLSELAWLSPRRLDALIRRLVDPLLRTLRKTFDARFDGDGTIEDL
FT                   IWFPAGC"
FT   gene            301962..302180
FT                   /locus_tag="PHG282"
FT   CDS_pept        301962..302180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG282"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86031"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX60"
FT                   /protein_id="AAP86031.1"
FT                   /translation="MVPGGVLIEKPGLASLLGRTQPSTHRPPERVMRLVLELLNLERKG
FT                   RHHDLVERCKALQSLHPSLFAKYMSSR"
FT   gene            complement(302197..302340)
FT                   /locus_tag="PHG283"
FT   CDS_pept        complement(302197..302340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG283"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to c-terminus of Coxiella burnetii
FT                   gi:10955994"
FT                   /db_xref="EnsemblGenomes-Gn:PHG283"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86032"
FT                   /db_xref="GOA:Q7WX59"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX59"
FT                   /protein_id="AAP86032.1"
FT                   /translation="MSQAVLASVLNTSLSTVRKWEVGDKKPSGPSVKLLNLIERKGLEA
FT                   VL"
FT   gene            302402..302821
FT                   /locus_tag="PHG284"
FT   CDS_pept        302402..302821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG284"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86033"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX58"
FT                   /protein_id="AAP86033.1"
FT                   /translation="MLLAGGKQYRRVMRAALARQYNTTLPAVQETTGGIGMQRSQLGAF
FT                   LDGLAPMFNEPMGHHPNGTPLYRRYGWIEAGAVTHLIYRAAPYLPTLQARVLALFQGPS
FT                   GPTADVEVEERFRGGTRIGSRWVGVADLHPLQEAA"
FT   gene            302818..303204
FT                   /locus_tag="PHG285"
FT   CDS_pept        302818..303204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG285"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86034"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX57"
FT                   /protein_id="AAP86034.1"
FT                   /translation="MSEFDKALHQEAKALSVNLDGTPEALLTVAHAGYKAWAKEGNLHF
FT                   PDETRYALLHEILRYCADECLLECYPSQERRLREIAEMLDQRYPRYACTRARLRARRNR
FT                   YGRICDDARRAPPASASNDVTSQS"
FT   gene            303943..304911
FT                   /locus_tag="PHG286"
FT   CDS_pept        303943..304911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG286"
FT                   /product="putative integrase/recombinase"
FT                   /note="similar to Ralstonia solanacearum gi:17549323,
FT                   Burkholderia fungorum gi:22983374"
FT                   /db_xref="EnsemblGenomes-Gn:PHG286"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86035"
FT                   /db_xref="GOA:Q7WX56"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX56"
FT                   /protein_id="AAP86035.1"
FT                   /translation="MGWVQIQYITAGMAKMDSLWLSNPSLAYRDWQAREAAGSDRRPFS
FT                   ARSIVQHQAMFENFRRHLLARSATVASFGTADIESFLQTPDARSYSPATRMRYVKLLDR
FT                   LCRHLVFAGVRLDNPAALMLSAERWPDQEPTPQFLDEAEDGRLQAYLQSPADDLSGLRS
FT                   RAIVAMFLATGITAAEARAARLGDLVPDTNPPYLFVTGHGARDARTVHVAEFAVSLLQA
FT                   WHARRSTLPVHGDLLFTLTPDGRPITDMSFGRIVAAALEAIEFSGVEPSPRTLRNTFCR
FT                   RQLLAGCTHDDVTRILGLASNRTCDRIAATISAARRRKILK"
FT   gene            305022..305465
FT                   /locus_tag="PHG287"
FT   CDS_pept        305022..305465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG287"
FT                   /product="histone-like protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980858,
FT                   gi:22979284; bacterial histone like domain; Pfam entry
FT                   PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:PHG287"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86036"
FT                   /db_xref="GOA:Q7WX55"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX55"
FT                   /protein_id="AAP86036.1"
FT                   /translation="MATKASAKTATKTAAKKAAPAKKAAPAKKAAPAKKAAAASPVAKP
FT                   LKDTFNKSSLLAHLVAQTELDKKTVQTVLTHLENTMVSAIHKKGAGEFTFPGLFKVSAI
FT                   QVPATKKRFGKNPFTGQEQWFAAKPASVKVKVRAMKKLKDAAM"
FT   gene            complement(305597..305794)
FT                   /locus_tag="PHG288"
FT   CDS_pept        complement(305597..305794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG288"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86037"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX54"
FT                   /protein_id="AAP86037.1"
FT                   /translation="MHLIVDIDIGGPTFQGTAGPAEAAQQLRELASEIERKVVDFSVCR
FT                   EGQRLAGTDGGCAIAYLADL"
FT   gene            complement(305989..308313)
FT                   /locus_tag="PHG289"
FT   CDS_pept        complement(305989..308313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG289"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980877,
FT                   Chloroflexus aurantiacus gi:22971274"
FT                   /db_xref="EnsemblGenomes-Gn:PHG289"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86038"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX53"
FT                   /protein_id="AAP86038.1"
FT                   /translation="MRPLKLMLTGFYGIRDGMKRDSVTVDLTTLPGGLIALVGPNGAGK
FT                   TTIMDNLHPFPIMPSHASKMSVDAFSYWDHLCAPRAEKDLEWEHGGKTYRSAFAFRNPG
FT                   KSRKAEYYLFEKDAGGDWKPLQLADGTLSDGKADTYNRCLEAVLGSPEAFFTSVFSAQN
FT                   RRPLASYQAGEIKKLLAELLGIEHLRDLSAKAGEVAKLLTRSLDTLQRDVLTLSGKRDR
FT                   AAVVAKEIWQVGESLDAQREARDVETATGAKLMQERATLAAKQEANAGTEARLRELNQR
FT                   KGELEQRAVLLGSDEQAAAGRAAVRRRDLDRNAASHRAVLAEASAIESAAGERDALQLA
FT                   IGRKQAELASQQATVEKLDAVQVEHAALSSELKGLEQRGASAAQLVKSLKLQADVIETV
FT                   PCWDDPMHAACPLLAQARNAKAGLSEQAVTVEALRDSYRKKLAQAQSMQDSLAARAQAR
FT                   SAFAALRADLERDQQSLQRLTALAARKPMLDAAREGLVQADRDLTALTEEEAARVDRHK
FT                   RDAADVQAQLEAVRRELAALATEDVTGMLGQMDRQIAASREGGAAIAGRIEALIRQEGT
FT                   LVAERERLDAELAGLPAAEAKTQALSDQIAQWKLLAKGLGNDGVIALSIDDAGPAITQI
FT                   VNDLLLACYGPRFTIAIQTQTELANGEKREGFAIDVIDADNDSTKDFSVMSGGQKVWIN
FT                   ECLTRGIALYRAQDAQQPFQTLFTDEADGPLDPERKRAFMKMKREVLRIGGYEREFFIS
FT                   QTPDLVDEADGVIDVLALAAQ"
FT   gene            complement(308301..308816)
FT                   /locus_tag="PHG290"
FT   CDS_pept        complement(308301..308816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG290"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980878"
FT                   /db_xref="EnsemblGenomes-Gn:PHG290"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX52"
FT                   /protein_id="AAP86039.1"
FT                   /translation="MILYHAGPDWLFVEEACMDRSVMAKRLADAHEFTQCMLYEPFGKG
FT                   RGTVIAKRGHMLVLALGEVGRNTFLAVAPSKELQDLIWSASNGLASQWSQLELRAITGL
FT                   EDWPAVIKMAAGEFAAARRSLERAIAGKPERDAPVVAELPVFDDNVMEMPPEYLHSFNG
FT                   TEVSECVH"
FT   gene            complement(308994..310454)
FT                   /locus_tag="PHG291"
FT   CDS_pept        complement(308994..310454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG291"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980879,
FT                   Thermosynechococcus elongatus bp-1 gi:22299520"
FT                   /db_xref="EnsemblGenomes-Gn:PHG291"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86040"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX51"
FT                   /protein_id="AAP86040.1"
FT                   /translation="MHNEGDSLLVAHFSDLHYSPGHLAEADRCFGFAVDDAIAGGCQVG
FT                   VVSGDSTDHRLDAHTPALSALARRVHQLTARMPVLMLQGTYSHEPPGTLDLFRLIGAQY
FT                   PVYVADRIHQVALCAGHFVPSVGPVFDTAEIDVLLAQHGIPEVVFTCVPTVNKAVLAAA
FT                   AGVASAATAVGDHLADYLRAAGTVNHQWRSRGARTIGVSHGTVNGCQTEHGVPMAGFDY
FT                   EFTIGALFDADCDAFMLGHIHRAQQWAQEGRVVAYPGSIGRFHYGEIGEKGYLRWQIAP
FT                   RRTEASLVATPARQSVCIDFDGPPDMAQLTEMATDAADKFVRIRWTVNEEHRQLVDREA
FT                   ITALFGASAEVKLEARVLPAVRSRAEGISRAATLPEKLGRWCELTGVEANPLMDCLSML
FT                   ETNDAQSIADRVLADLVADPVAAASDASPPEPVLPHVLTALVGMELEDDVGAPPVPPGS
FT                   KETDAKPALPSSSLTAPAMDWLTDDLFA"
FT   gene            complement(310551..311840)
FT                   /locus_tag="PHG292"
FT   CDS_pept        complement(310551..311840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG292"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980880"
FT                   /db_xref="EnsemblGenomes-Gn:PHG292"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86041"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX50"
FT                   /protein_id="AAP86041.1"
FT                   /translation="MHAPITYSEPGGRRSLLEERPTRPPIIGKIRPGIKVLTKAAREKP
FT                   EAVKIHDRMLAQGQSFERMGLEISRATGIKTPLVPKNVPWFTCRGSDFANPAVAEEIVQ
FT                   RYGEDRGDGNGFRLWRFPVIFAFDDWLSNMPNQLVAWTQSGRQFFSEYGPDGRRYCKMY
FT                   APPVRDARANRAKRTWGGRTIILRQDDDIPDGICDPHMCPQYQDGNCNLSASFYFALPA
FT                   ISGLGLIEMPTTSIYVLQKAHAAMQTVALARGRLVGVKFWMSKQEVEISRIDDSGRAVR
FT                   QMQWLITLDAEIDIAALLDGSDRRAPALEMATQAVAALEDEVQPTEQTPLQGDEATKLS
FT                   QVVDATAAHQVPVDGDDLESQFEDLMVRLGLANQEGRAQFRIYASATFGRGWTKRDQDV
FT                   RQLLGEMRTALTNPLAFREQIAAIAAEVAP"
FT   gene            311827..312261
FT                   /locus_tag="PHG293"
FT   CDS_pept        311827..312261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG293"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86042"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX49"
FT                   /protein_id="AAP86042.1"
FT                   /translation="MGACMVRPFSCQESERRRPGWTQHAPEGAGLCRPRAGSLRRWESL
FT                   TRRLPKRLAAPLARQKRKKPAPDCAGSELCYSEPAMPRPFRGRGTQGAAHNCALLDAED
FT                   VKSSSCSMVTLHSNPFREPTGSAAGSRIGSTAAVLPGRGL"
FT   gene            complement(312311..312679)
FT                   /locus_tag="PHG294"
FT   CDS_pept        complement(312311..312679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG294"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86043"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX48"
FT                   /protein_id="AAP86043.1"
FT                   /translation="MGLSPLADTLGGSCSAIFSCSRKRSLRVKLSDTTGHSMTLKAMAN
FT                   WRAFAFFATDFLCHNAFTPRVTDASTLTPGESIFCFKSCICARADWLATSVDISCAKCF
FT                   RRTLPSSARNTRSRGASL"
FT   gene            312816..313196
FT                   /locus_tag="PHG295"
FT   CDS_pept        312816..313196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG295"
FT                   /product="hypothetical protein"
FT                   /note="similar to C-terminus of Ralstonia metallidurans
FT                   gi:22980881"
FT                   /db_xref="EnsemblGenomes-Gn:PHG295"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX47"
FT                   /protein_id="AAP86044.1"
FT                   /translation="MARGGKVKALDEAFRDAEDWYGSALSWLSKTDQVEIPLFYEEKEV
FT                   KVSHSFAGRLLRLLMQFDRIFVETLYSQECGSISADQRTTTIQIAAKRITAIHQLCIPD
FT                   TDKFGPDGTLISSHRSSPDGHA"
FT   gene            313183..313866
FT                   /locus_tag="PHG296"
FT   CDS_pept        313183..313866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG296"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86045"
FT                   /db_xref="GOA:Q7WX46"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX46"
FT                   /protein_id="AAP86045.1"
FT                   /translation="MDMRDIEQLHAQYAQPPLTIDISPAGAATAPHLGYGGTSTAPARA
FT                   STSPFPFALRGNPRLLWGLGFVSAAALMFIIGTSIGKRESRAGTEQVQPVHSAPEASAR
FT                   VPAADGHEWPRKTNSVPASEVAQSTVLPVSGEAAVASTSAASAAAVPAEQTRERSPAEP
FT                   KAETVKRSAAPAAPAPALAPAPAPARAATVLAPAKTAQQLPTSAAPARNTAAQHANSPT
FT                   DIKMF"
FT   gene            313872..314282
FT                   /locus_tag="PHG297"
FT   CDS_pept        313872..314282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG297"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980882"
FT                   /db_xref="EnsemblGenomes-Gn:PHG297"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86046"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX45"
FT                   /protein_id="AAP86046.1"
FT                   /translation="MENPPIFSVLRAGMSIHGDIVSDHGFTCLALVTGNIGASRGLLHI
FT                   AAGGVVHGNVDGEHVIVDGVVEGDVVGRTSLLINGRVKGRIIYAGTIRLGPNAALDGTI
FT                   TRIQAVGYAPSPQKEGVAVTDSATEAVEPASS"
FT   gene            complement(314380..314976)
FT                   /locus_tag="PHG298"
FT   CDS_pept        complement(314380..314976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG298"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86047"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX44"
FT                   /protein_id="AAP86047.1"
FT                   /translation="MPMFGMEVVAFRSTKPRQCRGLFLLSLPMILTDFYSRYPRWLFRT
FT                   SDAKRPAFPGRNACRTTIGSDGQRVAGRLMQRQPIIVAHFHKERFHTLFDEWQSLVRQH
FT                   AIQVEYDAWMDQRYVQGPAFSVTLKRGRVVFDLVHGAMYEVRGKDGSGRIFRVQLANDF
FT                   PYVSFRDPASGVDFPWVAFPDVSTQAELMTLRRMY"
FT   gene            complement(315017..315985)
FT                   /locus_tag="PHG299"
FT   CDS_pept        complement(315017..315985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG299"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980883,
FT                   Pseudomonas putida kt2440 gi:26989219"
FT                   /db_xref="EnsemblGenomes-Gn:PHG299"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86048"
FT                   /db_xref="InterPro:IPR017686"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX43"
FT                   /protein_id="AAP86048.1"
FT                   /translation="MSHLVQTMAYVGATPWHGLGNQLESNQPLEVWADAAGMNWRIEET
FT                   DVMYRAGSHDLDPLHSFPQQKVLFRSDTKKPLATVSKRYQVVQPSEILDFYRDLTEVGG
FT                   YQLETAGVLKEGRKLWALARTGQSTKIAGVDEVRGYLLLATACDGTLATTAQFTSVRVV
FT                   CNNTLQIALGRSRGAVKVPHRSQFDPRAVKEELGIAISSWDGFMVRMHELADRKVSQVE
FT                   SERFFQRLFTYPWTKPDSNGPDKVNERGLKAVLNLFEGNGRGATLESAAGTAWGLVNSV
FT                   TEYVDHQQRARNAGNRLDSAWFGAGAALKQRAWDAAIELIA"
FT   gene            complement(316445..318001)
FT                   /locus_tag="PHG300"
FT   CDS_pept        complement(316445..318001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG300"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980884"
FT                   /db_xref="EnsemblGenomes-Gn:PHG300"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86049"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX42"
FT                   /protein_id="AAP86049.1"
FT                   /translation="MYVVHIGQQAENRTSLAGVLQLLNDDRDGRALPRVEDISVRHIER
FT                   GAIPVVRLASGNFAVRPTGTRRAILTMILDEVDRFIVRVGGKVLRPHEMSRASWGAVVA
FT                   AGRLAYFPAEAIDMSQGDAGPLFQTADLFEEKGAFDIAEFVCGEFVRRFGYGINGPLYA
FT                   PDASPNARHEVHVAYALMRGEKVRNCIVNTYRDNPHHGRHDLWMQPLIEVPALRGALSA
FT                   SVLQALCRTTRAEKLTITTRNVGKLLAALRHVPHDGCDVEVDDALFVAGILPPRTIPTP
FT                   KPPTAENAQPVTNLAARIHALISQRQFQESMDKAKAERESRRISQREFDRQACAAAAYR
FT                   AAYGYEWPNRVALAVMQRNVAAVLQIFDGPKDWNTDSKRALREEIGVDVLQCSAMTRRR
FT                   RLFELCGFSEAEQAEWEAHEVIEKAQKRAERELADAMRQAEAVKYRLETGQVMSGREYV
FT                   DFCIDAGFSQLIDEPRGSARRYLIHDPVKRASRPLRAKDGTLDYARARLAHVAVPVALA
FT                   A"
FT   gene            complement(318066..318455)
FT                   /locus_tag="PHG301"
FT   CDS_pept        complement(318066..318455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG301"
FT                   /product="hypothetical protein"
FT                   /note="C-terminus similar to Ralstonia metallidurans
FT                   gi:22980885"
FT                   /db_xref="EnsemblGenomes-Gn:PHG301"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86050"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX41"
FT                   /protein_id="AAP86050.1"
FT                   /translation="MDRIYGAGLASYPAGVLLRASVYSTNLRAAFSLVCADDGMPYGAL
FT                   SVNVPDADLAEDEILASAAWNLPADLKTVLLGTGKFVQTGRSNQVGLGRGEIWRIADPD
FT                   LLSQVAAARVVARRSRPVRRAAALA"
FT   gene            complement(318755..319225)
FT                   /locus_tag="PHG302"
FT   CDS_pept        complement(318755..319225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG302"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980886"
FT                   /db_xref="EnsemblGenomes-Gn:PHG302"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86051"
FT                   /db_xref="GOA:Q7WX40"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX40"
FT                   /protein_id="AAP86051.1"
FT                   /translation="MTSLIKVTFTSTSGEEVNGHAQYDPAAGMVTLPARLLELVNRATG
FT                   AGEGYAIVAHEDGYRIPLLHVENGSYRVDRARRQRKAFLLQAWKAVIAPTKDQRQQSGR
FT                   FAHTLSAAAVIGAAGYVGSGRVWTLSAVTDVLSLVGIGVVLFFVGAVLSKGD"
FT   gene            complement(319237..319536)
FT                   /locus_tag="PHG303"
FT   CDS_pept        complement(319237..319536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG303"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX39"
FT                   /protein_id="AAP86052.1"
FT                   /translation="MLRRFAGDMALSPRDYTIREHRQRRRDVDVFALHTDSLLVEIQHG
FT                   PGQEGGVRMSYRTCRGRHDLTGGRDNTVNVESLATDHGYANLVSTLRVVAGRRS"
FT   gene            complement(319797..320201)
FT                   /locus_tag="PHG304"
FT   CDS_pept        complement(319797..320201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG304"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86053"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX38"
FT                   /protein_id="AAP86053.1"
FT                   /translation="MFDTAETSPLTINPIETKGRYIFEVADDVRRQLRSASLEPEWLNA
FT                   ANFMDDDNEAMYGPKSSRQWPQLGARERLTVSVHRGWSEGWAVFVDRIGYAGEAPNLVT
FT                   TAQKLLVGKVLSERQAWDTVRAISKIFDLA"
FT   gene            complement(320288..320587)
FT                   /locus_tag="PHG305"
FT   CDS_pept        complement(320288..320587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG305"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to C-terminus of Ralstonia metallidurans
FT                   gi:22980887, Ralstonia solanacearum gi:17547511"
FT                   /db_xref="EnsemblGenomes-Gn:PHG305"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86054"
FT                   /db_xref="GOA:Q7WX37"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX37"
FT                   /protein_id="AAP86054.1"
FT                   /translation="MSAHTGVPGVLGAVVGAVLGARIIGDGNGRYLAGALSGTVSAVIA
FT                   QTAANQLSRRDGVEVIVRTDSGRQVVVTQDADQQFVSGEQLFLVSGAGGYRLTH"
FT   gene            complement(321439..322242)
FT                   /locus_tag="PHG306"
FT   CDS_pept        complement(321439..322242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG306"
FT                   /product="putative nucleotide-binding protein"
FT                   /note="Pfam entry PF00899; similar to Ralstonia
FT                   metallidurans gi:22980890; ThiF family"
FT                   /db_xref="EnsemblGenomes-Gn:PHG306"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86055"
FT                   /db_xref="GOA:Q7WX36"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR022500"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX36"
FT                   /protein_id="AAP86055.1"
FT                   /translation="MTFEHRIPANMTTRAWKVVVVGAGGTGSALLPNLARLHHAMLELG
FT                   HPGGIDCTVYDDDTVSETNIGRQGFYPVDVGQHKATLIVNRLNNLMGTRWEAHTRRVAS
FT                   GDRFVCDMAIGCVDTRAARKAILGAMKRGTGGYYLDCGNESDSGQVILGQVRGKAAQRL
FT                   PHVGDLFPELLDPKGDKADTAPSCSMAEALQKQSLVINQAIAVQAYNLLWTLFRTGTLK
FT                   YCGAFVNLAVGRTNPLPVDPQAWARFGYHLPEPKQRASRASRHAA"
FT   gene            complement(322239..322880)
FT                   /locus_tag="PHG307"
FT   CDS_pept        complement(322239..322880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG307"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980891"
FT                   /db_xref="EnsemblGenomes-Gn:PHG307"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86056"
FT                   /db_xref="InterPro:IPR018560"
FT                   /db_xref="InterPro:IPR022499"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX35"
FT                   /protein_id="AAP86056.1"
FT                   /translation="MNPADAALQQSFPSVMVPRFGALAPMERSGERLLIAANGVFLEIV
FT                   RPWLSVVRHLGAFQHRTAIPYGEAAETTDLRCGRIPAQLIGEFAAMARAAHPKETGGWV
FT                   VWNADSASFRLVPVQILEHSGGHLKYERPPLAADDVLVVDCHSHGRHPAFFSSTDDDDD
FT                   CHDVKFAFVMGNCDAATPSMALRLCAKGIFENVEKVPADWYAAAREEVLA"
FT   gene            complement(322877..323602)
FT                   /locus_tag="PHG308"
FT   CDS_pept        complement(322877..323602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG308"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980892"
FT                   /db_xref="EnsemblGenomes-Gn:PHG308"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86057"
FT                   /db_xref="InterPro:IPR022280"
FT                   /db_xref="InterPro:IPR032787"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX34"
FT                   /protein_id="AAP86057.1"
FT                   /translation="MAEILTATRSHDVALQGAILLYGQGPGQFSYATAHRIEPDGSGRP
FT                   VIGAGTPLNRMALIHAVREVAEASLPNGEFLTPNVLSISPTAVTWWCPAAQRRVFFDCK
FT                   EFGKRSAVVPHPALVFQASQSGFRVFALRGDERPVPASELCEPPYFNTWDHGKICIGSA
FT                   HVPKQIDVASIAGWEAGFFNSAFTHPNHGSKRVTYERGAYAFWKDMLDGQFPDYPKQVL
FT                   VPMKLKLADLIAGKLEKSS"
FT   gene            complement(323612..324751)
FT                   /locus_tag="PHG309"
FT   CDS_pept        complement(323612..324751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG309"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980893"
FT                   /db_xref="EnsemblGenomes-Gn:PHG309"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86058"
FT                   /db_xref="InterPro:IPR022283"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX33"
FT                   /protein_id="AAP86058.1"
FT                   /translation="MLFDPRSFVPEVDAGQPAWTPARQHPIARRRPAHDFLTLPAIPAG
FT                   VPNSGLLTFGDEVDVLGLVRAQFATGVLRANDVSTPTGAGDAFAQAMFAWLRARTPECK
FT                   RLSFGFSLIDIGAAKDQLMQFGWEDEIEAPLYLAIDMPGDDVYFIGEARASALRAVHPH
FT                   LLYTAMSLINTASAKSLFLRTPEALLDLFARWHWEYDSTLADDKNAREFLAESCDMDEG
FT                   DIERYLPSVVRPELAPDDVLPPACHGYPASSKLRAFGSRKLYELSRANNGWVKDLCVAL
FT                   AELNLTLKRQGDRSAVAGSQWAEPAYSAATLAYRQSDYVTQVLDDLYDGLNCSGDATLF
FT                   QCFIPIAGEPKAIRQQFRDLDGMLKTIAALDRVLTLISD"
FT   gene            complement(324842..325066)
FT                   /locus_tag="PHG310"
FT   CDS_pept        complement(324842..325066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG310"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980894"
FT                   /db_xref="EnsemblGenomes-Gn:PHG310"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86059"
FT                   /db_xref="InterPro:IPR022289"
FT                   /db_xref="InterPro:IPR032866"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX32"
FT                   /protein_id="AAP86059.1"
FT                   /translation="MALEIKKLLRQFSYNGMSFVDPGPAFTPEQVRDIYSAQYPELTTA
FT                   SVDGPEVKGEVASFTFVRAAGAKGAHARI"
FT   gene            complement(325077..325517)
FT                   /locus_tag="PHG311"
FT   CDS_pept        complement(325077..325517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG311"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980895"
FT                   /db_xref="EnsemblGenomes-Gn:PHG311"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86060"
FT                   /db_xref="InterPro:IPR022273"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX31"
FT                   /protein_id="AAP86060.1"
FT                   /translation="MFTELVPLVRASDKVVVTLSMHGDVMSVVVLPVIKNAADAALTSP
FT                   LVLSATPADLDAEFAAAVTSVSESHRSLAEQAEATKSILDAAKSTQSSNATKALAKAAS
FT                   PSASESESASDDDADADDAAQTEADAKVSAPSSVGTDLASLL"
FT   gene            complement(325592..327274)
FT                   /gene="parB2"
FT                   /locus_tag="PHG312"
FT   CDS_pept        complement(325592..327274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB2"
FT                   /locus_tag="PHG312"
FT                   /product="putative partitioning protein"
FT                   /function="plasmid maintenance, partitioning"
FT                   /note="similar to Ralstonia metallidurans gi:22980896; ParB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PHG312"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86061"
FT                   /db_xref="GOA:Q7WX30"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR022396"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX30"
FT                   /protein_id="AAP86061.1"
FT                   /translation="MQNPTVVIGKIRPGRNPRKYFDPVQMAELTESIRVDGILQPILIR
FT                   PVEGDENGHEYEVVAGERRYRAALAAHGEGYHIPVTLKVITDAEADRMALIENVQRADM
FT                   APSEEAVAASRIAGQLQGDRDEAARLLGWSRSTLDKRLALMNCSESVLNALNTRVIQLG
FT                   HAELLATLAKATQDKLLPVIVSEKKSVSELKKTIEAAACSLEKAIFDKTECASCQHNSS
FT                   LQTEMFGEAIATGNCTNRACYTEKTDRKLDSISYGLKDEYQVIRIVRPGDNHTRIQLQV
FT                   DGSTGVGEEQAKACHGCENFGAAVSGLPDSLGKVYSGQCFDTVCNQRKVAARLKAERDA
FT                   KAAAQKPAGGPAGSGKPAAAKGGDKSSASAEKPVTSISESEKVKNYRTDLWRKALRKEV
FT                   AQNADQANAYLISIALNGLARNIGGDKMSKFFEKLTEQKASSTLQGCLTAVHALDAGKR
FT                   QQLTVALTVAAIDGMEVPNLKELCRFHKLDLRAHWSLQKSQYFLEMLTKSEMKVLADEL
FT                   GIRKALGDSFAKLFNKPKPEVIAGLLAVDGFDYTGKVPKVLGF"
FT   gene            complement(327728..327979)
FT                   /locus_tag="PHG313"
FT   CDS_pept        complement(327728..327979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG313"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86062"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX29"
FT                   /protein_id="AAP86062.1"
FT                   /translation="MKANECSIAIGEGLATIKRRGTRGTTVAHILGTIEADGLEVVCLD
FT                   RLVHGIAESEMDGWQVIGAVTSVLARPIGPIPAKSSRN"
FT   gene            complement(327976..331089)
FT                   /gene="helZ1"
FT                   /locus_tag="PHG314"
FT   CDS_pept        complement(327976..331089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="helZ1"
FT                   /locus_tag="PHG314"
FT                   /product="putative helicase superfamily II"
FT                   /function="DNA unwinding"
FT                   /note="Synechocystis sp. pcc 6803 gi:16332119"
FT                   /db_xref="EnsemblGenomes-Gn:PHG314"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86063"
FT                   /db_xref="GOA:Q7WX28"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX28"
FT                   /protein_id="AAP86063.1"
FT                   /translation="MSNTWYAPLRALVSLGSQAEKIAHQGELHAARQRHLSQFFTPDAI
FT                   ARLMWGAVTHWQPNRKVSILDNSVGSARLLQFADPGTHSLYGVDVHQPTIEAVQHAIEA
FT                   AGFDGSFRHAGMEEIHPTRFDVALINPPFSIHLESPHLKPYDCTTWGRFGANTSALSHE
FT                   YGLYQALDAAQIVVALLPTTFVDKFAGLVIGHGEPFADAARRVVGVFDLPTSAFREEGA
FT                   EVRTSIAVFARYRMRARDFVRQAVSDLAEPLPALELQAEDRLYGEPRLGHQLLDDEGPA
FT                   ITRPVTSQKRVRISHDGRRIVLGFECGFVEAMVLNRVLERRIVSLEGQRLPRGFRYAGT
FT                   GRLDLEAYLVQPDPIGALGTLVAMVKSAGGEPEFAPGFLEHFRQRLRRSMRQALPLRHA
FT                   VWTTGVGAADTIVGTATKTHLVDSSVWGGPVIKAGQTVRFDRQPDGRYQYTVRDKCYVV
FT                   SLDEITTRYSVEKSAQAWEIVHEGMAVRYPGQAERLRKRLLALGIDRWLDWQFQQEDLV
FT                   ELLLKPNGAVAAWEQGCGKSRLAAGLILLSGVKHGLIVVEARLIAEMRAELEQVMPASD
FT                   VHVIQSPEDLVHLGRLNLIAYERLRMPVDRQASRRVTYAHRLRRRIGLLVADEGERLSN
FT                   PASDQSRALWQLSAKRRYILTGSPIASYPRDIFGLIAFTGGDGTAAQPYGYRRGYLEAN
FT                   WLASVQHAERGIDRFRSDFVVLEWVTWEFAESLQDGAKREVPKIGNLPRYRQMLAPHVK
FT                   RRLVCEPDVARFIRIAPPAVEVVETDWDPAHLSFYLRTADEFAQWYRDVRKVEGKSNNL
FT                   IAILARIRAVHFAANYPQHGVDGVGALGQLTSKQRAVIERLEAIAGEGKQAILFAENPG
FT                   VINLIASQLKAKGVETVPFHGGIPIAKRVADKDKRFVGGTATGLLCTKASGRAGYNLPN
FT                   ADYVLFYDRSWTWRIEYQAMRRALRWNRKGQLKVVYFHLPGSLDIYQDQMVAHKRDAME
FT                   AGLDWATPELEDEAFLHMDTLLDEFVDDLAKLHGRKARDQRELLKEAA"
FT   gene            complement(331167..331874)
FT                   /locus_tag="PHG315"
FT   CDS_pept        complement(331167..331874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG315"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86064"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX27"
FT                   /protein_id="AAP86064.1"
FT                   /translation="MYNARIEAFRAEETLSGFQAMTPASADLKRFCRKQVAEMIQRAGV
FT                   EFGIDGAPIAIDETRLAVDGYPNIWEAIRAGVVPDLDRFWNLLRDTYEADGPEKAEQQM
FT                   AATLVRAFGLASSSAVRRSTVFVRLKLIAISETVSDASRPSRQLHFGSLEPVTQAFAAL
FT                   AVFARRNGHAVLASCLAQFHPADVFESQQRRTFPGLDVIQYNEYWELRFATPVADTLLA
FT                   FVQRHVGISPQSA"
FT   gene            complement(331937..332722)
FT                   /locus_tag="PHG316"
FT   CDS_pept        complement(331937..332722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG316"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86065"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX26"
FT                   /protein_id="AAP86065.1"
FT                   /translation="MYKEIIEQFIAAQKAAHAAYAAAAAFERETVAAIPDHYRSVELRS
FT                   EYRTAQELEKFCRSVASGVVNRARREFAPQGARLDIAHEDEYKRAGLDIDAALRAGKVP
FT                   DIDGLWASMARRYGGHGGAELAYQQAAQRIISGFGLNRKREVKRTASAVVLRKHVTSEA
FT                   CYRRTARKVGYYSYQSTADCLSGLATFAAKAGHQLLAGALSQVNVHDVEYNYREKLSYP
FT                   GLDIVFFKDAWEFKVSHQVADDLMLFLGEYGEAFMQEAA"
FT   gene            complement(332839..333321)
FT                   /locus_tag="PHG317"
FT   CDS_pept        complement(332839..333321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG317"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980898"
FT                   /db_xref="EnsemblGenomes-Gn:PHG317"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86066"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX25"
FT                   /protein_id="AAP86066.1"
FT                   /translation="MFQKFLEIEVGPAPWEEECAQVGSDDYAKRSPMECAVYIRQLGRI
FT                   FGVHAPEVLSFVRRSFPHDFGRYHEVVACMNAAGHALFDESRLPAQWDHAARAELAWLC
FT                   LSDRYRRLLRDGDCELLDVPALYRLGTIPDFPDHPVAHWLALGLVPMPTGPALAFH"
FT   gene            333437..333607
FT                   /locus_tag="PHG318"
FT   CDS_pept        333437..333607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG318"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86067"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX24"
FT                   /protein_id="AAP86067.1"
FT                   /translation="MQQLREKPADENQELDFGNEVQLHGSKAIVTSGHKEVQRREQIDD
FT                   GRENSQRADTG"
FT   gene            complement(333783..334304)
FT                   /locus_tag="PHG319"
FT   CDS_pept        complement(333783..334304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG319"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980900"
FT                   /db_xref="EnsemblGenomes-Gn:PHG319"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86068"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX23"
FT                   /protein_id="AAP86068.1"
FT                   /translation="MSELPILKFREVSLGARPKGEREAIPPGDPSYDDIALMDALTFRR
FT                   YLDRVFWHPRSEVLRFEVRAVPSPAGRIYDVVALVAPGEGEVWFSEQALPARWDYVAIT
FT                   EINYGLSKRLRSELKATGKIPDDYQAFDDGPLPDFSNLENPEEVAQRRWAVVDRLREAN
FT                   RRDRIGAKRG"
FT   gene            334374..334913
FT                   /locus_tag="PHG320"
FT   CDS_pept        334374..334913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG320"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX22"
FT                   /protein_id="AAP86069.1"
FT                   /translation="MIRGATCAPAALTSRRPRYLGCKSNPNLPAMRFSCLERHTPIDFN
FT                   TRRQAAFARKQQRERDRYPLFADHVAAEQHSPDEELARRQRRSDNLERTTRALHARVWR
FT                   EKRAIYFSLSDEQRAEIRAKWKAWTGPTTALYFAYIVDTVSGEYERRSEAARADTLAIR
FT                   RRVLASLPEQTALEIA"
FT   gene            334913..336373
FT                   /gene="uvrD"
FT                   /locus_tag="PHG321"
FT   CDS_pept        334913..336373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="PHG321"
FT                   /product="putative helicase superfamily I"
FT                   /function="DNA unwinding"
FT                   /note="similar to Ralstonia metallidurans gi:22980901"
FT                   /db_xref="EnsemblGenomes-Gn:PHG321"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86070"
FT                   /db_xref="GOA:Q7WX21"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX21"
FT                   /protein_id="AAP86070.1"
FT                   /translation="MVPTDEQASVVDAVKAGGPLKVKAYAGAGKTSTLRLAAEARGRAR
FT                   GLYLAFNKDIANEAAQKFPQNTRCRTVHSLAYSATPPELTRKLKNPVEPPHQLALRYGL
FT                   AKLRLPTTIGKDLELSASKVARIVMDGAARFCRSAQAEPLAWHIPVESIVKEEEAEHLR
FT                   DSLLPYVKRLWGEYLDPASPSAIVHDVYVKRWERSRPRIGADFILFDEAQDADGLMLSV
FT                   LRAQQSQVIYVGDPYQQIYEWRGAVNAMEHIRAPECALTESFRFGPAIAQLASRVLRLM
FT                   DEETPVRGQDHVESRILHDSTPGQDRFDAILCRKNATVLTHLAQGIGRGDRVAVRANVD
FT                   ELRAFADGAEQLMRGQRIGYPATLALFETWEEVQEYAESFAGRDLKPLVTLIDNEGVDY
FT                   LRLILTRVSPEDEADYIVSTVHRAKGLEWERVQLAGDFKFKTGDDGELTMAPEEMRLLY
FT                   VAMTRAKRLLDVSEIRRDLYTMFREAGV"
FT   gene            336384..337613
FT                   /locus_tag="PHG322"
FT   CDS_pept        336384..337613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG322"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980902"
FT                   /db_xref="EnsemblGenomes-Gn:PHG322"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86071"
FT                   /db_xref="InterPro:IPR009553"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX20"
FT                   /protein_id="AAP86071.1"
FT                   /translation="MITVRIGGNEYPLDEVLEDPGRYARHLERAKTIQGFAECGCAEGR
FT                   PRPKLVIRRHRDIFLLARWPEQAFRHAEGCPFHRKTQTTPGAADSLDAFRMRDGRHDIR
FT                   LDASLSVSTHTPAKTVQRTPKGQFTKPQRRSAGLLALLEFAWEQAGLNVWPGTGARSWN
FT                   GCWSQLTAELDDCRINGKDADGLLHVMQRWDPARKSEILAEFEAWQARLSPTAAGNPRG
FT                   ILIGEIESHAATQYGGKVVLRQSTQRFFMSSGLYERLQASFGTALAGIGRAEQRCVAVL
FT                   LVEKSRSNYLTVVDIGAMLANRQFLPCDSSHEVAMADHLVALRRAFRKPLRHIGRAEVH
FT                   PDFVLTDVQPETVIEVLGMAGNPAYDARTASKRQHYQTAGVPFLEWDAVATSISSVRVP
FT                   PAGTRAADAR"
FT   gene            337603..337974
FT                   /locus_tag="PHG323"
FT   CDS_pept        337603..337974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG323"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980903"
FT                   /db_xref="EnsemblGenomes-Gn:PHG323"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86072"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX19"
FT                   /protein_id="AAP86072.1"
FT                   /translation="MHADRIPIADALYGKALELVHQHRAASVALLERHLGLGLDMAEAL
FT                   LQRMARETTAVRRVPSGLYLYTHGPIGEELAALHGFAQEVLAALASDSVDVADLRAAAG
FT                   RYGLPVPRQAAPTRPPRRR"
FT   gene            338446..339567
FT                   /locus_tag="PHG324"
FT   CDS_pept        338446..339567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG324"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980915"
FT                   /db_xref="EnsemblGenomes-Gn:PHG324"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86073"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX18"
FT                   /protein_id="AAP86073.1"
FT                   /translation="MSENTKIEWTDHSWNPWEGCQHVGPGCDHCYAETRNARFGGGQAQ
FT                   NWGPGAPRRRTSATNWRKPFRWNLAHAAFAAVHGRRQRVFCASLADVFDNEVPIEWFID
FT                   MLDVWRQTPNLDKLVLTKRIGNAMKRLGEAFNALMLRDDCAENPLVPWLATWIAGNAPA
FT                   DIWLGATIVNQAEAVRDIPKLLRVPAKTRFLSMEPLLGHVDVFSTITGELLHTSGNDYN
FT                   PGSIDWIIAGGESGSDARPMHPAWSRSLRDQCAAAGVPFLLKQWGEWHTASVLTTSGEP
FT                   AFRTFETFEQWVNKASTWVGGGICLDKHGQQLQKGDDFIRARDECRFPVTVMDRVGKKA
FT                   AGRQLDGMLHDAFPVTSLDVAEACHRALGRGAV"
FT   gene            339567..340808
FT                   /locus_tag="PHG325"
FT   CDS_pept        339567..340808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG325"
FT                   /product="putative DNA methyltransferase"
FT                   /function="DNA modification"
FT                   /note="Pfam entry PF01555; similar to Ralstonia
FT                   metallidurans gi:22980916"
FT                   /db_xref="EnsemblGenomes-Gn:PHG325"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86074"
FT                   /db_xref="GOA:Q7WX17"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX17"
FT                   /protein_id="AAP86074.1"
FT                   /translation="MRQLDLFAHVAAAFADASEDGLSTGALYDIVARSAGIDHSAATAR
FT                   VPIGTAKALHSPFKRAVRWHQQTLKTLGVVERVADRTGFWRLTQPVTKDLDRAADGVKL
FT                   VAFSTMLGMAIWARNEDVFRGLAEPIALCVTSPPYPLRQARAYGNPTDNQYVDFICGAL
FT                   EPIVANLVTGGSIVLNISNDIFQHRSPARSLYMERLVLALHDRLGLALMDRIPWVNYSK
FT                   PPGPTRWACVDRVHLATAYEPLLWLTNDPGRVRADNRRVLQAHTERHRRLLEAGGEQRS
FT                   ASYGDGAYRIRPQSFGNPTSGRLSRNVVERGHRCADTLAYRRAAATLGLPAQGAMQPTA
FT                   IPDFFTRFLTEPGDLVVDPFGGTIRTGLAAERLGRRWIVTEWILQYARGAAELFRQSDG
FT                   FLMHPALQWASQGR"
FT   gene            341141..341731
FT                   /locus_tag="PHG326"
FT   CDS_pept        341141..341731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG326"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980918"
FT                   /db_xref="EnsemblGenomes-Gn:PHG326"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86075"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX16"
FT                   /protein_id="AAP86075.1"
FT                   /translation="MPSGLFQCAHCGGAPTYVAGRLQAVIACDECGMSTPPVENDPRNR
FT                   DAAFPRLSAIWNSRVDLRPADKEAISMIARRALTSSDIPYFLNLLASTTSDWEANGPMF
FT                   ATMAAALTQPGYEFKHVGPPETVLSQAARYQKLLQRAKVIHIDGAPMVRFEHVPALAAE
FT                   VAEEGLADQDWPLLDMEEFVGKAIDSLPDHWQP"
FT   gene            341734..342678
FT                   /locus_tag="PHG327"
FT   CDS_pept        341734..342678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG327"
FT                   /product="putative endonuclease"
FT                   /function="restriction of foreign DNA"
FT                   /note="SMART domain SM00477; similar to Ralstonia
FT                   metallidurans gi:22980919"
FT                   /db_xref="EnsemblGenomes-Gn:PHG327"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86076"
FT                   /db_xref="GOA:Q7WX15"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX15"
FT                   /protein_id="AAP86076.1"
FT                   /translation="MPSGGQAEGVSTSTEFPSDDPPASRSSRSLPCIPHGKRTGHGTGL
FT                   CSRPAYGPTHDSTSGPHAVAVLPRLRRSLFEPDTHRAVVCRASHAGGRRRRAQAATRQR
FT                   LLRRGATARSRPRQAGRLPTRIGHGSRAPSGDFPDKASQAESFSLANVIPQHSVSNRRT
FT                   WSHIETSTRRLARQHGAIQVVTGPAFVGTPRTLGHVHIPDFIWKAIHVPGIGAAVYLVR
FT                   NDATPAYSVISVAELRHFAGIDPFPTLPKAMNATAMDLPLPTPHPGEKAARRVAFAWLA
FT                   SGEAAAASRATEPLHQAIRDASAILSLALAHAR"
FT   gene            complement(342779..343123)
FT                   /gene="hupB"
FT                   /locus_tag="PHG328"
FT   CDS_pept        complement(342779..343123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="PHG328"
FT                   /product="putative histone-like protein"
FT                   /function="DNA condensation"
FT                   /note="similar to Ralstonia solanacearum gi:17548076"
FT                   /db_xref="EnsemblGenomes-Gn:PHG328"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86077"
FT                   /db_xref="GOA:Q7WX14"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX14"
FT                   /protein_id="AAP86077.1"
FT                   /translation="MQTRAALPGRQCLLFPWKRRIMTKAELIEAIAAGVDGLTKAKAEE
FT                   ALNVTLHAIMDAVAKGDALSLVGFGTFSKGERAERMARNPRTGEEIKVEAARTVKFKAG
FT                   QRFREAVNQE"
FT   gene            complement(343309..344466)
FT                   /locus_tag="PHG329"
FT   CDS_pept        complement(343309..344466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG329"
FT                   /product="putative regulatory protein"
FT                   /note="Pfam entry PF02954; similar to Azotobacter
FT                   vinelandii gi:23104622; FIS family"
FT                   /db_xref="EnsemblGenomes-Gn:PHG329"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86078"
FT                   /db_xref="GOA:Q7WX13"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024456"
FT                   /db_xref="InterPro:IPR024457"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX13"
FT                   /protein_id="AAP86078.1"
FT                   /translation="MIKTIHLRPIINQYNLPERFKTEFALLAAEHLHLPHSGTRVSGRS
FT                   LSQMSQRQRLQALLAMFVELRSVGGMAVNSPYSIRQKHVRWLVQYWVGDRKLNAGTVEL
FT                   RLTHLRALMSWMGKTNVVGRIDDYVERPAGYARSYIAREDKSWEGKGIDAAAKIAEIEV
FT                   TDAHVALQLKLEAAFGLRAMESWRLRPALDVLPSGMLHVHDGTKGGRPRRVPIEFGWQY
FT                   ELLGKAATLAYATNPEKGTLIPATYTQIRWRRRFYTVLEKHGVTKNGQGVTAHGLRHQF
FT                   LQQMYQRESGQAAAVKGGGKVVDVQAHREAMRKVVEAAGHSRATKANAYLSTYATQLSI
FT                   GRTDPTLEDVKAAIAAAGGNKAVAARELGISRTKLYRILAQEVGR"
FT   gene            345557..346555
FT                   /locus_tag="PHG330"
FT   CDS_pept        345557..346555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG330"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980922;
FT                   secreted or periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PHG330"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86079"
FT                   /db_xref="InterPro:IPR022389"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX12"
FT                   /protein_id="AAP86079.1"
FT                   /translation="MSTNTIAVDVGYGNTKFAFPLGADVAASMFPSLAPTRSASSLASH
FT                   GGGYFQARDVVHVTVDGAEYEVGPDVSITSAYGNNGRTLSEDFVTTPEYAALLFGALHY
FT                   SQARDVGQLILGLPVHTLQKYAGALQERFTGAHDFGAGDVTIKRVVALPQPLGSLVTFM
FT                   RQSGKELDPDDNCLIVDVGYFTTDWVVARGYMMDDTRSGGVPGGSSRIYKQVATLLSAD
FT                   EGGEPTGDIERIDKALRQGKLMRYYEKMVDLRPYFEVAKAQCQMAVKEMQTRVGRTEDI
FT                   AAIVLTGGGSALYSGAIRAAFPRSHIVAMDSPCFANVRGFFDIGSARQARG"
FT   gene            346566..347117
FT                   /locus_tag="PHG331"
FT   CDS_pept        346566..347117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG331"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Acidithiobacillus ferrooxidans
FT                   gi:10945166"
FT                   /db_xref="EnsemblGenomes-Gn:PHG331"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86080"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX11"
FT                   /protein_id="AAP86080.1"
FT                   /translation="MEKLAIKVALSPLTTPRLCAQLAEISDPRLRAEVLRRLAELGAEA
FT                   ILSAGSGAAVQPPAGGILAALTYRPDRNPPPTPAPAPAPTPAPAPTPTPTPTPTPAPAP
FT                   TPAPAPGPAPAPVQALAPSSAAPTRLEAQPADTIAMSSQAASQASVSNIAPQEPEGQTV
FT                   GPQGNLDLNAVNSAMSRFFD"
FT   gene            347195..347326
FT                   /locus_tag="PHG332"
FT   CDS_pept        347195..347326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG332"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86081"
FT                   /db_xref="GOA:Q7WX10"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX10"
FT                   /protein_id="AAP86081.1"
FT                   /translation="MQFFDYLSTNHDINRFVFAVVICYCVIEAVVHCYRGAKARKAG"
FT   gene            complement(347404..347610)
FT                   /locus_tag="PHG333"
FT   CDS_pept        complement(347404..347610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG333"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86082"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX09"
FT                   /protein_id="AAP86082.1"
FT                   /translation="MPQKGFTMIVNRLHIHAMRSTPNRDVQAGQSEAQFFHIYRRDESG
FT                   RMVLVERSLSLDSAFDFCLPTLH"
FT   gene            complement(347713..348795)
FT                   /gene="pri"
FT                   /locus_tag="PHG334"
FT   CDS_pept        complement(347713..348795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pri"
FT                   /locus_tag="PHG334"
FT                   /product="putative primase"
FT                   /function="initiation of DNA replication"
FT                   /note="similar to Salmonella typhimurium lt2 gi:16764263"
FT                   /db_xref="EnsemblGenomes-Gn:PHG334"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86083"
FT                   /db_xref="GOA:Q7WX08"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX08"
FT                   /protein_id="AAP86083.1"
FT                   /translation="MKMKDLSEIVASWSSDQWDALVAQYLPASALTDAFWRGRPGPCPM
FT                   CGGRDRFTYTRKRNRGDWVCRKCNDGSPAGGDGLELVRRYTDMSYLELKCRLNGQSIDP
FT                   VPVVSHKPRPSRREAMSPADLLRCVMKQVSTSKPLTAGDHGMRYLATRVPGLCAPLPQG
FT                   LRLATQEYWHEKEIVGRYPTIVAEYRLPDGRIATVHRTSLDPHKAEKALVISKDGEILP
FT                   SKRNYLTALPLDGGAVRLMSPRNGEIGVAEGLESAYAAYMLFRVPTWFCLNRVELSRFV
FT                   VPDGLGIHTVHIFADFDTVDVKTGKSPGMADALTLQKRLRAAGFTVVLHRPKVRGTDFC
FT                   DQWRTEYQLRQMSQPAAVAA"
FT   gene            complement(349009..349575)
FT                   /gene="ssb"
FT                   /locus_tag="PHG335"
FT   CDS_pept        complement(349009..349575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="PHG335"
FT                   /product="putative single-strand binding protein"
FT                   /function="helix destabilization"
FT                   /note="similar to Ralstonia solanacearum gi:17545141"
FT                   /db_xref="EnsemblGenomes-Gn:PHG335"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86084"
FT                   /db_xref="GOA:P59927"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59927"
FT                   /protein_id="AAP86084.1"
FT                   /translation="MASVNKVILVGNLGADPEVRYMPSGDAVANLRIATTDRYKDKQSG
FT                   EMKEATEWHRVSMFGKLAEIAGQYLRKGSSVYIEGRIRTRKWQDQSGQDKYSTEIVADQ
FT                   MQMLGGRGGASDGDSDSGTDRSASQQSPASAQRSAPTGQRQPPARRQPAQPPSNGFGDF
FT                   NEDIPFARPAALDGIPFRNDGAPRY"
FT   gene            complement(349588..350373)
FT                   /locus_tag="PHG336"
FT   CDS_pept        complement(349588..350373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG336"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980925"
FT                   /db_xref="EnsemblGenomes-Gn:PHG336"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86085"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX06"
FT                   /protein_id="AAP86085.1"
FT                   /translation="MTLFQVIKQAAAAIMGQPAAPSLRADEVPVGTGADNEYQIQINGV
FT                   PNLFRDEGDHVVHFVAVFDSQIQHTAYGDKVLPEVVPRWSKLGRHEGDGVTPQSVAESV
FT                   MRQAKERQPVATPAGPENSADSRQSGRAERQMPHRAPANSAEARQEGHASRSNYTVGTL
FT                   IEWGEMEFPNRKPGGKATYTSFAVRLDTSAGEKTLQGEGLKDALADVACNIGDRVGIKR
FT                   LHKEKVPAFHHATGRPILDPATGEQKLWDRWVWQVNRIH"
FT   gene            complement(350382..350810)
FT                   /locus_tag="PHG337"
FT   CDS_pept        complement(350382..350810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG337"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980926"
FT                   /db_xref="EnsemblGenomes-Gn:PHG337"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86086"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX05"
FT                   /protein_id="AAP86086.1"
FT                   /translation="MESTTAGWQLDFFGEAAVIVLPPPKVEPLPDPSLWSESVREGMVD
FT                   ALISLACDSRRGDNMPESLIDCAELLRARIKNKPLELEEYSMTLGWIFGYWDGALPYSY
FT                   VCAVCGVSPEVLQDVILNNARLRADLDGVKRMCCGSLL"
FT   gene            351909..353075
FT                   /locus_tag="PHG338"
FT   CDS_pept        351909..353075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG338"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980928"
FT                   /db_xref="EnsemblGenomes-Gn:PHG338"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86087"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX04"
FT                   /protein_id="AAP86087.1"
FT                   /translation="MKKKEEESREFNLVDPKSPNAMRELVTQQLGHFIDAGAIGRIVQA
FT                   AQEIELSRKRILAEHTAIGSRLFQIYHSILTCVQKRLGDTPRARQEADDSLYALAVRGM
FT                   RISRASVIKYLQAFHHFSENHDALTFLNLGELTILKRSDITNEEVQRFIDARKNDESYS
FT                   RKEILPYIEWSRRTHQDLNHVMATLEAAEEQLNESLERQRDLEAQMRHMREQMNSADAL
FT                   NAAQKDQLDRTSGALTSQQHAMDSLQLSITRLNEERQALQKALADSRIREVVREVKVEV
FT                   VPAEYKDLSDAVIGESSKLDATKAQVKEAERRLAEVNAELEQHEAKEADSRSLALRIDG
FT                   LKADLDDALAKLRSSVKAIKVKEHGAALLSLRRSAEAFHNELIAITGA"
FT   gene            353078..354250
FT                   /locus_tag="PHG339"
FT   CDS_pept        353078..354250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG339"
FT                   /product="hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980929"
FT                   /db_xref="EnsemblGenomes-Gn:PHG339"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86088"
FT                   /db_xref="GOA:Q7WX03"
FT                   /db_xref="InterPro:IPR007944"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX03"
FT                   /protein_id="AAP86088.1"
FT                   /translation="MQSTLTRSIFEQFVLPAWVRDRVLSANLRISNYVLNTVSVHPTLE
FT                   NVFRVSSENLRSLRENIGQSSKVLGTSFLAYAPTLTTVEDWRSFIEGRMPTVTMERLKA
FT                   MVPHSLSVVDRLALEHTNRSYINAVYDLLNMSVLAAPLIGISNELASYLRSIPQHQFDV
FT                   AMTERLIPLFHWRFADEMFWLEIHTGRLSREMIAHYLMETSPLRSDRLPHSGVWGKFRL
FT                   ETFERDALFEAFLSFSCRAMSVCSLFNTSIEHTRKTYQRIHGKSSPSGQPPASLMWYLE
FT                   SAQRRVQATFQIWLFRSAIACDVSTPESFVAMLDIHRAFFADDCNVPAERSLHLARSMS
FT                   TSEELAVWPCRKCGTPYLASNSSAKIELSQSFLCPCCNGTLIPSRGGRRN"
FT   gene            354361..355284
FT                   /locus_tag="PHG340"
FT   CDS_pept        354361..355284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG340"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86089"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX02"
FT                   /protein_id="AAP86089.1"
FT                   /translation="MNVADPTYSEGSGQLALFKGVNTLRQKLGVGLLAQDAALDTAAQA
FT                   HAVYLSAHSVAQHDQTPGSQHFYEATPLLRAQKAGIGDSQWVAEVVGAARGPNDREIGL
FT                   GCIDQWYHTVYHLQSLVTNQESIGIGYSSIGALGLNHCVLDFGTSTATQPSPTPNGVPY
FT                   GGGQQFDAETFVTVPADGDIGVQGGFNFAGESPNPAPDLPTPGRPLMVYANGALAEVLS
FT                   VTAFKLVARNGAEMPARVLVSPAAKADGSAGVADEYLRNNAAFLLPLAPLADRETYTAS
FT                   FTGTRAGKPVSLSWTFRTAAPTTALR"
FT   gene            355339..355671
FT                   /locus_tag="PHG341"
FT   CDS_pept        355339..355671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG341"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86090"
FT                   /db_xref="GOA:Q7WX01"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX01"
FT                   /protein_id="AAP86090.1"
FT                   /translation="MEWITIAIAFALPAYLAFKWARQEDRWAWPWAIACMVFSYFGLLA
FT                   FVLTREGLPTVSEYARKYPTCVTERGMSCYRCGSRSIRLWREQPFIAVHQWHICNSCGT
FT                   SLYRSR"
FT   gene            355833..356918
FT                   /locus_tag="PHG342"
FT   CDS_pept        355833..356918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG342"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Xanthomonas campestris pv. campestris
FT                   str. atcc 33 gi:21230755; secreted or periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PHG342"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86091"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WX00"
FT                   /protein_id="AAP86091.1"
FT                   /translation="MGKLKVTVDPRPAKVRGRKTNMQNSKLTLSVLATAMTLALAACGG
FT                   GGGDDGGSKNPTTPPTTPTTPTTPQVPTSVPPATSVGTPTYPAGDFRLASYTDLNNYRL
FT                   AMGVGALRQDAFLDAAADNHLAYMKANALLAHEETVGKPGFTGVNPYEQAVAAGASKNQ
FT                   WVSQSASMSAFCVDSFKNSVYHLQGITSNQETIGVANRDGYCVINFGLSTGANGSGYGL
FT                   PSWGGQQLPAGGMAYSPVDGERVVGSFTPAGESPNPAPDLTAAGHPIMFRVPAPESTDV
FT                   LTVSNFSLAGPGGAVVPVRVLVPSKAKSGSVSNAVEDARLFAGVVFMLPTQPLSAGTYT
FT                   ATFSGARNGIAINKSWSFTAF"
FT   gene            complement(357521..358768)
FT                   /gene="pilV"
FT                   /locus_tag="PHG343"
FT   CDS_pept        complement(357521..358768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilV"
FT                   /locus_tag="PHG343"
FT                   /product="putative adhesin precursor"
FT                   /function="type IV pilus assembly"
FT                   /note="Salmonella enterica subsp. enterica serovar dublin
FT                   gi:08896035"
FT                   /db_xref="EnsemblGenomes-Gn:PHG343"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86092"
FT                   /db_xref="InterPro:IPR007001"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWZ9"
FT                   /protein_id="AAP86092.1"
FT                   /translation="MEAILGYLIALMLSMLSFAGFVTWAKAGVTNVQTAAAASQMLVFD
FT                   KAALQFVQDEAATLVAQATPSVPVNITPAMLINGGYLPAGFSATNVFGQTWLLQVLQPT
FT                   PNNLQALVTSQGGRAITDTRQLVQIAAQAGAQGGFVPYAGQNGDPTMVANRAYGAYGAW
FT                   QVPLANYTNPGSGRLASLLAFTGVQANNGYLYRAQVPGHPELNRMQTSIDMAGNDVNNA
FT                   GRVTATTALTSQGDTYLTSTGAPGTACAVDTSTRRSTSGTGHVICSGGIWQAVGTAVAN
FT                   IFEGLGCGNNGQIATSATNVGYVCKGNRYITLNNALGNMNVTRKFENVTDGMTFPKDNC
FT                   PGGTAWAMYTPKQEMVNITGNVIPPIQGTFFSMNDNGTFWYAQASAISPAAWYSGNDTG
FT                   ALGGQLVGTVTTGCTF"
FT   gene            complement(358776..359255)
FT                   /locus_tag="PHG344"
FT   CDS_pept        complement(358776..359255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG344"
FT                   /product="hypothetical protein"
FT                   /note="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG344"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86093"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWZ8"
FT                   /protein_id="AAP86093.1"
FT                   /translation="MGYLILPIAAVLFSLGIVAQSWQLSQAAPGAGVPGRMDSVATVTA
FT                   QQAQAYGAACVSTADATPGLVGASLIPALPSGMAAPTGAGCMAVANPGGGRDVYGYVRV
FT                   KSGAGAALLGSTQGSLAWFRVRSQGTAINISTGIAYSVPSTIPVGALVHWVQLNT"
FT   gene            complement(359292..359792)
FT                   /gene="pilS2"
FT                   /locus_tag="PHG345"
FT   CDS_pept        complement(359292..359792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilS2"
FT                   /locus_tag="PHG345"
FT                   /product="putative prepilin type IV pili"
FT                   /function="type IV pilus assembly"
FT                   /db_xref="EnsemblGenomes-Gn:PHG345"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86094"
FT                   /db_xref="InterPro:IPR014911"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWZ7"
FT                   /protein_id="AAP86094.1"
FT                   /translation="MDGILGRIVAIVLGLLALAGIAYAGYNGFQNHKASVVATNISQLI
FT                   TNARAGFSQGSNGYTNFTTANIPAMITGGMFPSDMVRGTTLLDPWGNAVTLSAASAGSQ
FT                   GVIRFGGGNAQTAKQCVSTAMGLKDYVSLAVGTTTFTQANLPDQATAGAVCSATATFTL
FT                   TFQ"
FT   gene            complement(359884..360384)
FT                   /gene="pilS1"
FT                   /locus_tag="PHG346"
FT   CDS_pept        complement(359884..360384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilS1"
FT                   /locus_tag="PHG346"
FT                   /product="putative prepilin type IV pili"
FT                   /function="type IV pilus assembly"
FT                   /db_xref="EnsemblGenomes-Gn:PHG346"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86095"
FT                   /db_xref="InterPro:IPR014911"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWZ6"
FT                   /protein_id="AAP86095.1"
FT                   /translation="MDGILGRIVAIVLGLLALAGIAYAGYNGFQNHKASVVATNIAQLI
FT                   TNARAGFSQGNNGYTNFTTANVASMITSGMFPSDMVRGTTLIDSWGNAVTLASANSGSQ
FT                   GVITFGGGNAQTAKQCVSTALGLKDYVTLAIGSTTFNQTNLPDQATAGAACSATSTFTL
FT                   TFQ"
FT   gene            complement(360421..361461)
FT                   /gene="pilR"
FT                   /locus_tag="PHG347"
FT   CDS_pept        complement(360421..361461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilR"
FT                   /locus_tag="PHG347"
FT                   /product="putative component of type II secretion
FT                   apparatus"
FT                   /function="type IV pilus assembly"
FT                   /note="Pfam entry PF00482; similar to Escherichia coli
FT                   gi:10955359; gspF family"
FT                   /db_xref="EnsemblGenomes-Gn:PHG347"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86096"
FT                   /db_xref="GOA:Q7WWZ5"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWZ5"
FT                   /protein_id="AAP86096.1"
FT                   /translation="MSGLSWAMRRRLYQQASSQLENGLTLAQVIEDFRERQDRRGRKRA
FT                   AEAAHEVGRQVRDGKALMAAMGTSLSDLERSVLDAGEKAGQLPDAMRLVLDVRELTTRL
FT                   RRKLQASFFAPTVYLATLYVVLLLIGGYIVPQFLDILPIGKWTDWAYAMYWMGQLAVGW
FT                   PAPVIFGSLGAYAVWSWWALPRWTGPGRRFCDQHVFPFTAYREITGFTWAMSFVALLRA
FT                   KVPDIAALEGQIGSASPWLASRLRPIRLGLADGLDLAESMRQTGNGFPSLDLIDEVGAY
FT                   AGFDDFTEKITVAVRQNAEVIERQLLAKGMVMSAIFTGLMFLAFVVLQLGSNSLSSILT
FT                   SSTGQF"
FT   gene            complement(361458..363260)
FT                   /gene="pilQ"
FT                   /locus_tag="PHG348"
FT   CDS_pept        complement(361458..363260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilQ"
FT                   /locus_tag="PHG348"
FT                   /product="putative traffic warden ATPase"
FT                   /function="type IV pilus assembly"
FT                   /note="Pfam entry PF00437; similar to Escherichia coli
FT                   gi:15667834"
FT                   /db_xref="EnsemblGenomes-Gn:PHG348"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86097"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWZ4"
FT                   /protein_id="AAP86097.1"
FT                   /translation="MIATISRLWRSPRSKSARGTAFATRAEPSVKSDALALPKPPEVLE
FT                   PHILYPRNLPATFDRVACNLDHLTADQAAALRQRVAESGLHVEDVARELGLTDDNVQQV
FT                   LAVHGCDIYVDARHFGTPRLLTWEAKVRRSGAAPQVRKVSAQELAVLRQQRGAGQQQDT
FT                   DLQTLTLARRLIADCAILVASDIHILVREDHTEIQVRIKGDLRTVSAQSMRREEGERLI
FT                   RAIYTGLATVKAATYNPLDVQDAQIAGDALPGTGLSSVRIVRGPAYPVESGGGFLVARL
FT                   QYREHHEGALKADAIDAAKRLDLRTPKVPGGEFKLGQMGYTPLQVELISQLLRRPMGVI
FT                   VVTGPTGSGKTTTLFECTRHQARLFPQKRLITIENPTEYPMDWAIQLTTESERFPEMLR
FT                   MTLRMDPDAVLLGEIRGVEEAIATLQAAATGHQVLTTLHVTDPFETFSRLVMLDHVRLA
FT                   MDVIANHTQIIGLIAQRIVPLLCPKCSVTLDKASEPLPDYMLNAMRSWGDLSEVRVRGS
FT                   GCDHCHGQAIIGQQAVAEVVVTSEQLMQDFIDDGVLAARRNHRRREGSDKPMIAHAMDL
FT                   VLAGRLCPVDAEGSVDAIPMREHL"
FT   gene            complement(363257..364504)
FT                   /gene="pilO"
FT                   /locus_tag="PHG349"
FT   CDS_pept        complement(363257..364504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilO"
FT                   /locus_tag="PHG349"
FT                   /product="putative component of type II secretion
FT                   apparatus"
FT                   /function="type IV pilus assembly"
FT                   /note="similar to Salmonella enterica subsp. enterica
FT                   serovar typhi gi:16763014"
FT                   /db_xref="EnsemblGenomes-Gn:PHG349"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86098"
FT                   /db_xref="InterPro:IPR009663"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWZ3"
FT                   /protein_id="AAP86098.1"
FT                   /translation="MAEILSFPGLKGGFAIGLTWHHEEKQPSKSVLRARALELGRNVRW
FT                   GVVHESAEGAIQTGFCEAIAGAKPAGLKPLAAIVAGQHRQPWRGLFHLQGSLYWYIAVR
FT                   QGHAVIAGGDRVGTLEELAPVRERHRALGEWTEVEGTVRDLANMARASKGVSAMRDVLT
FT                   GPWKSTSYTVAAAAGVAALFVGGWYWYDQQQEAEREAQLMRQRAIAAAQRANEAARQRA
FT                   VPWVDEATPTAFLQACRRAWDRQALADAGWTLSSWRCKPATSTALTIEITWKREGGLAA
FT                   NAPGALSADGNQATATGNAPAAFLPSSRAVNRPAEAQRSMWTYAQGTGVGLQLTSPPPL
FT                   LPADGNTPVDPWLAMTADFGFGAPPWLGLGEGLDAVAGLRLTEVSYDGAAQAWKGTGRL
FT                   YAMRDGAVPPAGSQQQ"
FT   gene            complement(364508..365023)
FT                   /locus_tag="PHG350"
FT   CDS_pept        complement(364508..365023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG350"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Sinorhizobium meliloti gi:15966805;
FT                   secreted or periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PHG350"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86099"
FT                   /db_xref="InterPro:IPR022753"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWZ2"
FT                   /protein_id="AAP86099.1"
FT                   /translation="MTSQAGTGSAAQPVAGSPAAANGTPTAAAAETAQPSRTTDAPELA
FT                   ALQSQLALWKARAEIAKFKAEVKRAEDSMVAAPAGAPPGAGVPSVSLGGPMPTGGVAER
FT                   APRLAPEAPRLVSLRAFDGHYNAVVDVSGRTVPVQAGDSLDGGWKVVSIDDGGVKLANG
FT                   KRVRTLRP"
FT   gene            complement(365189..366847)
FT                   /gene="pilN"
FT                   /locus_tag="PHG351"
FT   CDS_pept        complement(365189..366847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="PHG351"
FT                   /product="putative component of type II secretion
FT                   apparatus"
FT                   /function="type IV pilus assembly"
FT                   /note="Pfam entry PF00263; similar to Escherichia coli
FT                   gi:10955355; GspD family"
FT                   /db_xref="EnsemblGenomes-Gn:PHG351"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86100"
FT                   /db_xref="GOA:Q7WWZ1"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWZ1"
FT                   /protein_id="AAP86100.1"
FT                   /translation="MRNTARYTAAIVAAATLLSGCGVMETRNLQDTIGSDAHAAYADAP
FT                   RSRPVFRVHEGAWLMGEKIRASKPQPDIYNKHVVFRGTLGSLTEAASWIAQSIGVRATV
FT                   DASAVATSVSGTAPTQPAGAARPTGPIPMGGTPRVDLATSLAGTSASGQGAGMALSVPL
FT                   TLRYEGSFKGFLDAVEAHFGVWSRYNDGTVSFFRTETRTFMLPSLADSSSMNGSITTSD
FT                   SSSGGTAGAGGNGGSGGSGAGRSGQSMTMSTEMKPWETLQATAKAVAGASADVVVDKNL
FT                   GTLTVTGDPVQCDRIEQFVKSLVAMYGKQVAIDVQVYEVRVTREDNFGLNLSLAYQSSS
FT                   GKPDVSFSSVSTPTISGSATAMNLGATIMSGPFAGSKAVVQALSTLGNVSQVVSRSGVT
FT                   QNGKVLALQTATLQDYVAQSQTTLAANVGSTSSIQTGTVTYGFTSNFLPKVVDGRILMN
FT                   FDMTLSDLLPLQRFNSGGDANQTSVQLRTMPTNRFTQSITLKPGESLVLTGLRNQKAST
FT                   TNNGVGEPWMAALGGGVGALKGDTVIAIMISARLL"
FT   gene            complement(366859..367362)
FT                   /gene="bfpG"
FT                   /locus_tag="PHG352"
FT   CDS_pept        complement(366859..367362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfpG"
FT                   /locus_tag="PHG352"
FT                   /product="putative BfpG-like protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980938"
FT                   /db_xref="EnsemblGenomes-Gn:PHG352"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86101"
FT                   /db_xref="InterPro:IPR018927"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWZ0"
FT                   /protein_id="AAP86101.1"
FT                   /translation="MCQSNRTTRIAVAAASLLSGLILVPAVHASQLSNDGWQHLQPLRA
FT                   PKAAVNPTMLAANTPSVVAAAPNKASTPAGPGAAPTVGAAFRLVKGEALQQQLQNWANR
FT                   AGWTVAWNVPDGWIVPGDKDYGSDFESAVKRVVEELANNGADVVGDSWRGNRTVIISQN
FT                   GMVQ"
FT   gene            complement(367391..367825)
FT                   /gene="pilT"
FT                   /locus_tag="PHG353"
FT   CDS_pept        complement(367391..367825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="PHG353"
FT                   /product="putative transglycosylase"
FT                   /function="type IV pilus assembly"
FT                   /note="Pfam entry PF01464; similar to Ralstonia
FT                   metallidurans gi:22980939"
FT                   /db_xref="EnsemblGenomes-Gn:PHG353"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86102"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWY9"
FT                   /protein_id="AAP86102.1"
FT                   /translation="MRIGAIAVVCTVLLTGVAHADCLDDAAVFHGVSPSLLRSIAMQES
FT                   TMRPWVTSRNANGSEDIGLMQINSIHLPRLSRYGITRAHLFDGCINAYVGAWILRENIQ
FT                   RFGPTWKAVGAYNASSPDKQLRYANQIHARWQALQRAALR"
FT   gene            complement(367822..369039)
FT                   /gene="pilL"
FT                   /locus_tag="PHG354"
FT   CDS_pept        complement(367822..369039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilL"
FT                   /locus_tag="PHG354"
FT                   /product="putative PilL-like protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980940"
FT                   /db_xref="EnsemblGenomes-Gn:PHG354"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86103"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWY8"
FT                   /protein_id="AAP86103.1"
FT                   /translation="MAADTDPLDFDYQVVARAADRPAMVFNDGLSTYIQPRHGQAVQAD
FT                   GAIQSGPYWVIDGVPDVVRYSVSGQPVVARWKRANGFTSEPVSPVGEMARSPAAISGRL
FT                   ALIGSYASQPLVRAGRSNLPLAQLVKSIAPAGWSGTAQKDIPLTEEVTLETRDGENWLQ
FT                   ALARVLEQRNLYAEVDFSRRNIALRAGPPKSFAVVEGGVAAATPDGKLQAAAPTADTLP
FT                   AGHVDAVTPVAGTPLPDGPTLASAFGALAIRDTKQGRIEIRFEQEPKDLVLRDASDSKI
FT                   WTRWDEAQRVLSFATVDRFTATADGKSVDVTRTPEIDYEFPNQNGAGLEMVFEKDGATY
FT                   LSFAKSLVSVSVFGDEHQRNGELKDRYYRFNGIAARLTVIADGSVVYVDRVPQVRFKEQ
FT                   PGKVAL"
FT   gene            complement(369087..369884)
FT                   /gene="trbN"
FT                   /locus_tag="PHG355"
FT   CDS_pept        complement(369087..369884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbN"
FT                   /locus_tag="PHG355"
FT                   /product="putative lytic transglycosylase"
FT                   /function="type IV pilus assembly"
FT                   /note="similar to Ralstonia metallidurans gi:22980941"
FT                   /db_xref="EnsemblGenomes-Gn:PHG355"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86104"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWY7"
FT                   /protein_id="AAP86104.1"
FT                   /translation="MTKRFAAFVVCAVASLAAQAATMDAVISPNAIVVKVDGQARVHTL
FT                   EGKPVLYCGLEPFLGWSARLLGAQIDPGAEAGPVVTLAGKTVPIAALFVREGWLRPPVL
FT                   NDAAQEALAERRGGWACAPKTEPFAQMGSRVDPRITAGIAMNESSYRGRPWPWTLNVAG
FT                   RGMFFSTREEAYAAINRLLANQRCDFDVGLMQVNWCYHGKRFASPWEALAPATNIRVAE
FT                   DILTENLQRSGSAMKAVAWYHSANPERGGPYFSRFMKHVAQFR"
FT   gene            complement(369877..370806)
FT                   /gene="trbI"
FT                   /locus_tag="PHG356"
FT   CDS_pept        complement(369877..370806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbI"
FT                   /locus_tag="PHG356"
FT                   /product="putative channel-forming protein"
FT                   /function="pilus assembly"
FT                   /note="similar to Ralstonia metallidurans gi:22980942"
FT                   /db_xref="EnsemblGenomes-Gn:PHG356"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86105"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWY6"
FT                   /protein_id="AAP86105.1"
FT                   /translation="MPDTKKPVLTAADLNGGGKAAPTVDAKKNEEDDLFTAPVFKSGAR
FT                   KSQLNQGRVPAGIADVSDPAQMRAIQQAVAARQGAANAAALAQDNATPQQVSGDRQFLR
FT                   DAGSMSTLRTGFDGKLPKCTVSRGFVIPATFAGGLNSDKPGEFRATVSQDIYDTVQGTC
FT                   KVIPAGSTLVGMYSADIAVGQERLLTAFVRMQLPNGKTVPLLGMQGADPDGTAGNSGDV
FT                   NNHFLRIFSGALVIGALSLRFNDNPTTTTVGPAGLVAYGNAAGQIATQTAQTILNRNQN
FT                   IRPTITTDPGQRMMVQVKHDIVLEAYRD"
FT   gene            complement(371118..372032)
FT                   /gene="trbG"
FT                   /locus_tag="PHG357"
FT   CDS_pept        complement(371118..372032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbG"
FT                   /locus_tag="PHG357"
FT                   /product="putative cannel-forming protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980943"
FT                   /db_xref="EnsemblGenomes-Gn:PHG357"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86106"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWY5"
FT                   /protein_id="AAP86106.1"
FT                   /translation="MPMEARTPSRLLPLAIALGLALLLSIPDGNAAEKNGRRLGAGVAG
FT                   LGIGDLSDAMNPGNPFNGGVDPIALPGDSRLVVFTYSRDQIFRVLSAPLKVTTIEFPDD
FT                   EQIVGDPAWGENVRWDYDTDGANHLYVKPQAAGLVNTLSVNTNKRSYEFTLVSSPLGGI
FT                   FYQKVRFRIPTSISAKVKARNDARDEQGEDARSAGAEARNPDAVGVSPDQLNFEYSISG
FT                   TASFKPETAFDDGKALWLRLPAAALQSWPVALVKDGSDFVVVNQIRRGGYLVVQRLADT
FT                   IVLRSGDDEIKIERGRRRVLGLF"
FT   gene            complement(372042..372692)
FT                   /locus_tag="PHG358"
FT   CDS_pept        complement(372042..372692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG358"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980944;
FT                   secreted or periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PHG358"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86107"
FT                   /db_xref="GOA:Q7WWY4"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWY4"
FT                   /protein_id="AAP86107.1"
FT                   /translation="MYGEERPEQVIFDRTTRITVDRNHWKLATVGAACVALAAILTREP
FT                   PPSVVKVVGVSADATGKPITRELDAFHPDERQVKVALKDLVQRWFTIEPILTPQIESSR
FT                   MAGNLRSVREQMLGSAKEQFKAWVDEDEPFRQVMSAPTLTREPKFTNIASLPDSTVVVE
FT                   FVTTTTEDGYKPRKQRYAITFRYQVKPADKEAMLGTNPFGVFPIFFSIQKSAA"
FT   gene            373128..374177
FT                   /gene="trbB"
FT                   /locus_tag="PHG359"
FT   CDS_pept        373128..374177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbB"
FT                   /locus_tag="PHG359"
FT                   /product="putative chaperonin"
FT                   /function="conjugative DNA transfer"
FT                   /note="Pfam:GSPII_E(37-313) similar to Ralstonia
FT                   metallidurans gi:22980945"
FT                   /db_xref="EnsemblGenomes-Gn:PHG359"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86108"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWY3"
FT                   /protein_id="AAP86108.1"
FT                   /translation="MESASTNHPLLQLTQLADSAVSMFFESLAPLHDVIHADDVAEVMI
FT                   NRHNSIWVERRGIMTRLEIEIDPFKIEGAIRSLASSVEKSAVRGTAQGIINAGQKGLRI
FT                   AAVMQPTSIDGHALSIRRHREKNMRLSDYVKAGAFSSRHARTETETPIFCGPVEDDALA
FT                   QALGELVRLRKNILVAGGTSSGKTTLLNAMVGEIPPEERVITIEDTTELKPSVPNVVRL
FT                   LSNADKGVTTQHLVALSLRFRPDRILVGEVRGGEAYDMLQAFNTGHDGGMGSLHAPSPR
FT                   MALSRLESMALLGIPPGSGWKVEDMRRLIADCIHYVVHMKRSGDMRVLSEIIEIKGFRN
FT                   NDYEYQRVF"
FT   gene            374197..374544
FT                   /gene="trbC"
FT                   /locus_tag="PHG360"
FT   CDS_pept        374197..374544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbC"
FT                   /locus_tag="PHG360"
FT                   /product="putative prepilin"
FT                   /function="conjugative mating pair formation and DNA
FT                   transfer"
FT                   /note="similar to Ralstonia metallidurans gi:22980946"
FT                   /db_xref="EnsemblGenomes-Gn:PHG360"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86109"
FT                   /db_xref="GOA:Q7WWY2"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWY2"
FT                   /protein_id="AAP86109.1"
FT                   /translation="MTSPFSQRARATARKYAPSALLLVGMMAVATSAVAADDSFLGNLG
FT                   NFICGIATFINTKYLFVIGLIVIVLGAYAYANAESSLSKFISGACVGVGLAAAAPSILK
FT                   TLNIVAACTGF"
FT   gene            374563..374877
FT                   /gene="trbD"
FT                   /locus_tag="PHG361"
FT   CDS_pept        374563..374877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbD"
FT                   /locus_tag="PHG361"
FT                   /product="putative TrbD-like protein"
FT                   /function="conjugative mating pair formation and DNA
FT                   transfer"
FT                   /note="similar to Ralstonia metallidurans gi:22980947"
FT                   /db_xref="EnsemblGenomes-Gn:PHG361"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86110"
FT                   /db_xref="GOA:Q7WWY1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWY1"
FT                   /protein_id="AAP86110.1"
FT                   /translation="MSIGLSMPRLIAGAVRGLAIANGTIVALLIYVTYRSGWEIPVSIF
FT                   VIGLCTHALLAWLTSRDPWWNQILNVYNMYGDLYESVPWHGKSDAVFRRPYGFDSDLPC
FT                   "
FT   gene            374871..377327
FT                   /gene="trbE"
FT                   /locus_tag="PHG362"
FT   CDS_pept        374871..377327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbE"
FT                   /locus_tag="PHG362"
FT                   /product="putative TrbE-like protein"
FT                   /function="conjugative mating pair formation and DNA
FT                   transfer"
FT                   /note="similar to Ralstonia metallidurans gi:22980948;
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG362"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86111"
FT                   /db_xref="GOA:Q7WWY0"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWY0"
FT                   /protein_id="AAP86111.1"
FT                   /translation="MLKLKRRPLAEIVPWLTSLTPELILNKDGSLLATYEFRGVDADSA
FT                   DASDITSARDQLDQACRSFDNRITAWWRLSHRRTTGFIDGEFSNAADARLNALNRTHMT
FT                   TGRYFRNTHALSIAYTPESGIAKFFEKIGYHMTVGGRSVYGAIVEAAKDTVLSRSAFAF
FT                   DMEKMRADTRRFEAMLDAFAGGIPRIKPTRLTMQDSYAALHQVANPSVPPRRIRYPVTL
FT                   LDTHLTESEVTVGAERLLFESAHGKRYAAVVAVKEWMSFQEAALDSLLQVDAELDICIM
FT                   YRFLDTARATAYIEKVRRFYKMAAVNLRSMMKQYVSKEESENDEGREELAKEAGHALKR
FT                   LTAEGVQHGFANISVIIYADSESECEDAVSEVVGALTNAGFGAIREKANLMPAWNSTLP
FT                   GRWDKQRRLQFVETPAVSDIAPVRSVLEGPTFNAWLSEKTGAEVPPLTCLPTRHRTIQR
FT                   VDMHQRGGNGHLFVIGPIGAGKSVFLNFLVSQGDRHKARRIRFDKDRSTRIPTLLSGGT
FT                   FIDVTGKFQTGTPVNPLSLLADPANFTYVTEWLTLALEDDDFTLSPQQVQDLFEAVKLV
FT                   AGYPRERWTLSSLSTMLHADLRARLQIWLKGGQYGHFFDHAEDAFAVSDNLCIEMGELF
FT                   QKYERAAVLFTDYAFHRISQSMDGIRYTIIEVEECGFFFQNERFYRRYEDWITTIRKLN
FT                   GAIWSATQSLRQIARVANFEILKENIANWVYLPNGQAKTSPELYKDKFGLTDDQVQLIS
FT                   EAVPNRDYLLITNTQTRMLQTAFSDEMVAMLRSDGVAQSICDKHHASGGPDWQDRYVRE
FT                   MLARAA"
FT   gene            377343..378101
FT                   /gene="trbJ"
FT                   /locus_tag="PHG363"
FT   CDS_pept        377343..378101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbJ"
FT                   /locus_tag="PHG363"
FT                   /product="putative TrbJ-like protein"
FT                   /function="conjugative mating pair formation and DNA
FT                   transfer"
FT                   /note="similar to Ralstonia metallidurans gi:22980949;
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG363"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86112"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWX9"
FT                   /protein_id="AAP86112.1"
FT                   /translation="MKKWIANIAIATSVFGASSAHAALPVTDWVGLIQTTMTAMQSLKT
FT                   EVYENTNIAYQYKMMANQLLQSTGLDAASLTEQLDAIKDDIGKYEVYGTTLKDLYGTVS
FT                   DNADYLKKIQSMVVASGKTKEQWFQDQRQLLSNGDKTAKNLFSLGEQIFKNTQSVAQRR
FT                   QKIQAQVKLSPTAQAAAQSTNQMLDVLASQNSDLLQLMSVRAQADADKDQQSVARETQS
FT                   AEAMRAITTAQDEELRQLRARVFSRKLQAD"
FT   gene            378206..379162
FT                   /gene="trbL"
FT                   /locus_tag="PHG364"
FT   CDS_pept        378206..379162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbL"
FT                   /locus_tag="PHG364"
FT                   /product="putative entry exclusion protein"
FT                   /function="conjugative mating pair formation and DNA
FT                   transfer"
FT                   /note="similar to Ralstonia metallidurans gi:22980950"
FT                   /db_xref="EnsemblGenomes-Gn:PHG364"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86113"
FT                   /db_xref="GOA:Q7WWX8"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWX8"
FT                   /protein_id="AAP86113.1"
FT                   /translation="MIGSQAEESTKTPPSFSGQKGTIAESLKSWVGQFESFRSGLIASA
FT                   TPLSQTIRSETDKVAYGLALITLTLAGIRFAATNDPTTAWTDIFEAFMLLGIFAGIYLG
FT                   YDKFAPGIFDWFKMLGDKIAGTRSSNPALTLISVGTGFLDTYNKAMDAASGLSVLSVAL
FT                   SGIVLIITFVVCAVAALLYSFFIALGEVQAAVGIVVGPLAVALAFSDYSRRFFVSWLDF
FT                   MISASMYTVVASVMARLVSSAFTSTMVDQTDIGTQSLAGAAYALGVAIFMLLVALEIPK
FT                   MAGAIFGSGGGLSGGAAGRLGMKAASGIGGFLAKKGK"
FT   gene            379162..380418
FT                   /locus_tag="PHG365"
FT   CDS_pept        379162..380418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG365"
FT                   /product="conserved hypothetical protein"
FT                   /note="Providencia rettgeri gi:20095137"
FT                   /db_xref="EnsemblGenomes-Gn:PHG365"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86114"
FT                   /db_xref="InterPro:IPR011119"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWX7"
FT                   /protein_id="AAP86114.1"
FT                   /translation="MTDHHHLTPAALLASHDSRLALVRQYANESDDGDFRTKWLSVLDR
FT                   CAAWFSSMPLRPTEHAEPGGAFRATVEAAYFAMRLSGAQKFAADQTSERRRKLEPQYLY
FT                   ALFLAACCSRLDEPCRHFQFHRMRDGAEWVPAAHGAFGAWLGDDTYRVTRREAPLPSER
FT                   MRTALLAREILGTERLGAFDSQVLTDLFGAINPDPRPAGLETLLHKVVRQAIETVTQFE
FT                   LKARRAAFAPDTTPAPSAQALAVDAITGASTPPAQARTETAPVPETGTATPVEVEQPET
FT                   TTEADPSSPAGLHQAGSDASAQHRASPNAVQLDGARSLRKEAPAEDPFKAIAGTSNLMR
FT                   EFFKALSQDAAAGKTKVTRVEGKVAISKRSLGNYGIASETLIENLRKFKHLYKIVGQDI
FT                   LLVNEVGDLILPASQAPEA"
FT   gene            380415..382280
FT                   /gene="traG"
FT                   /locus_tag="PHG366"
FT   CDS_pept        380415..382280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="PHG366"
FT                   /product="putative channel-forming protein"
FT                   /function="conjugative mating pair formation and DNA
FT                   transfer"
FT                   /note="similar to Ralstonia metallidurans gi:22980952; TraG
FT                   family; TC 3.A.7"
FT                   /db_xref="EnsemblGenomes-Gn:PHG366"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86115"
FT                   /db_xref="GOA:Q7WWX6"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR022458"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWX6"
FT                   /protein_id="AAP86115.1"
FT                   /translation="MNQYINHFRPIYEFRAVVGWALAVLLLLVSGMPNSGYFALGGMAF
FT                   LLFRSSQVWRALRFRLSISTKWLTLVRIDDLLTQSRKLRSDDKDDDAMYLGTGYEWTQK
FT                   HCQIAHDILRMPSSDIPGLPKWLPKDTVKAIEKTFAPENSIADRSPQGKSWIGGMESLR
FT                   IPVPFHYKAMGGHTSISGTTGSGKTRTFELISTQVIHNPNDILIAIDPKNDPDWVARCK
FT                   RECERTGRKFLYWKQAAPSQSIRLNPLENWSQPSEIPTRIAQLMEEGPFRQFAFLFIDR
FT                   AVKGELYVGDKPNLRSILQYAQNGINNLLERGLERFFPEAGKPDWEEEAAGYMQKVAQK
FT                   AGGTRLDAMVSLYIDRFSKLGNGHEAIDGLISTYQHDRDHYGRIIASALPLLQMLATGE
FT                   TGLMLAPKADDFEDDREIWDIDKVIKQKAVLYVGADSLSNSMVAQAVMSMLLADIASVA
FT                   GAIYNFYAKPPEIVLVVDEAAEAINEQLLQLLNKGRGAGFKAFVAYQTRSDFTAKLGNV
FT                   AKMQQVLGNLNNQIVLRLEDIDTAQWFSEKAGTTAIRNLVVSSSTSTGTEAHIGEFSGS
FT                   VSRSAQLEKVPLIPHDLVMQLPNLQYFLRISGGAVYQGRIPIIKD"
FT   gene            382287..382793
FT                   /locus_tag="PHG367"
FT   CDS_pept        382287..382793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG367"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980953"
FT                   /db_xref="EnsemblGenomes-Gn:PHG367"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86116"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWX5"
FT                   /protein_id="AAP86116.1"
FT                   /translation="MRSSLFRQIVKDYKLSAKLSPVFSLSPDLDDICTRVVDYIGVNFR
FT                   VREEPLVKEMLADGIAAWRAARKQGDPNVAFMKGLFSRAHELYGKRYAAFKGEKYNVWY
FT                   PFHESIPAFELRQPEGYVCRVVDEPAPGAITQRCAAFQLAARVLTGYTFTRYFENYDVA
FT                   GNFAQ"
FT   gene            382768..383064
FT                   /locus_tag="PHG368"
FT   CDS_pept        382768..383064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG368"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980954"
FT                   /db_xref="EnsemblGenomes-Gn:PHG368"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86117"
FT                   /db_xref="GOA:Q7WWX4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWX4"
FT                   /protein_id="AAP86117.1"
FT                   /translation="MSLATLHNDARRLAIRLKQVPARMAARLCGVDPALALHMHEWLTA
FT                   PPPGAPAMPQAFTTEAAAACFALIKISVVKPAVFWGALVAFLSLPVLLALRWS"
FT   gene            383066..383683
FT                   /locus_tag="PHG369"
FT   CDS_pept        383066..383683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG369"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Ralstonia metallidurans gi:22980955"
FT                   /db_xref="EnsemblGenomes-Gn:PHG369"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86118"
FT                   /db_xref="GOA:Q7WWX3"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWX3"
FT                   /protein_id="AAP86118.1"
FT                   /translation="MANSRFASHVRLWLIFSPLMICTLAPFIQDESAFEISEAEQASVE
FT                   RVLGQEKADVAVTLANARFRQWFIESGVVKSSFSGSDAQTGFADNGASDFGRSWMQHFW
FT                   LTIYRALYRAAVGHYWLVGAIVLFLALFNDGTVSRKIRAAGAGFANPVSFHVAAHGLML
FT                   CFGFGASALLLPLPMLATWWTFGVCLVGLLCWRLAASFHVGK"
FT   gene            383738..384589
FT                   /locus_tag="PHG370"
FT   CDS_pept        383738..384589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG370"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86119"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWX2"
FT                   /protein_id="AAP86119.1"
FT                   /translation="MTTTDLTPADEPLQEVGPTDDTVALLAEPPTTLGSIDSSGDVETE
FT                   LAEMEQSADVLRNEGLISTADHEERKAKVERTRKLFRDLPSEDRQAIVRRRRELGLLIL
FT                   NRELAGAAVVPVALKLNHTRLRPLFEQWWPYMNRMSLNLQRFGAATFSRTELSTLENYL
FT                   ERELSKIEDYVDEQLRVAKAYREQREQEMRARGEIVFVPTIQRPSLALEVQAYSRFSVR
FT                   ALQVLIKFDQTMDQFDFMVWNGIRDQSDVNDEVTRFLRKFQPLGLRSYTTHLRLMTTVR
FT                   CI"
FT   gene            384767..386494
FT                   /gene="helD"
FT                   /locus_tag="PHG371"
FT   CDS_pept        384767..386494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="helD"
FT                   /locus_tag="PHG371"
FT                   /product="putative DNA helicase superfamily I"
FT                   /function="DNA unwinding"
FT                   /note="Pfam entry PF00580; similar to Leuconostoc citreum
FT                   gi:08928266"
FT                   /db_xref="EnsemblGenomes-Gn:PHG371"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86120"
FT                   /db_xref="GOA:Q7WWX1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWX1"
FT                   /protein_id="AAP86120.1"
FT                   /translation="MSLEKVLEGLNPAQREVVDLRQHCVAVAVPGAGKTATIAAKAAVL
FT                   LANPDVTVGAVTFSKDAAVELRDRILALAGADARKRLLAGTFHSLAYKQLGKGTGKLTD
FT                   IVHDGVRFAIVGQILQEGGFDGKVEDAIAAIERAKMQLSDPPSGTVEAQLYEAYQSALA
FT                   RNGKIDFQDMLRLAVAGMQSGTIAPYRMTYLLVDEYQDCDSLQSRWTALHAAAGSIVTV
FT                   VGDDDQSIYGFRSALGFRGMEAFIKEFDARSVILGKNYRSHAEILDVADRVIRNNEDRI
FT                   LKELVAHRGPGGAIEFKRLEDEYKEAVSAVEALTPVLRAGKTAAVLARTNRILDPLEAV
FT                   CRSHGVKYYRAAGRSILDRPEAALMGDLLELIQKSKDSGTDALLGFAGIGSHELQLLHT
FT                   QTAAKPEGSIPRKKNLVQAGIAEATVDKYRDFLKKLAEWQALFERQFFSLVLDGVREWM
FT                   LKFVADDPGKRAINTAFDVLTRLNGPFSERLLFLRQKNNEPADDALVLTTMHASKGREW
FT                   SAVVVIRAEETIVPDEASPESEERRLFYVALTRARDWLQISTAKKNPTSRFVIEAGLT"
FT   gene            386814..388004
FT                   /gene="repA"
FT                   /locus_tag="PHG372"
FT   CDS_pept        386814..388004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="PHG372"
FT                   /product="putative replication protein"
FT                   /function="DNA replication"
FT                   /note="similar to Ralstonia metallidurans gi:02120964"
FT                   /db_xref="EnsemblGenomes-Gn:PHG372"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86121"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWX0"
FT                   /protein_id="AAP86121.1"
FT                   /translation="MSYRFDGLPIAPRTTTCGGAPHSPAPIESEASKRKAARCDARRLP
FT                   ERVLRAIALVYESDGLRALHITNRQVLATLIRFALNQKDPTSLAFIKKATIAQHLSISE
FT                   ATVYRALGTLEDAGLIERERQQRTRAQLEVVGRIGFTAKLLQCIGLAGRELGYPEPQTD
FT                   SDESRSRSACLAPVSGVNNPKQSSTKKHSGPREFVQIHDRAVPIDLAPLVRDQELTTSA
FT                   LFLLMRLAREAGHRLSDVVSAAGHVLGPLRGRELFAYLKSLLGKPIDYSYVVQTRKAQE
FT                   DERRATAAQAAQDRLEVAQLVERYRGQRVSAPDGRIYEVDSASIVITEANGRRSSLGHD
FT                   QARAWLIEMDRAATGLSRALAQPSSATRSSSAMAQAAIEQLRSILGGRPAPNMVGG"
FT   gene            complement(388395..389762)
FT                   /gene="repB"
FT                   /locus_tag="PHG373"
FT   CDS_pept        complement(388395..389762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repB"
FT                   /locus_tag="PHG373"
FT                   /product="putative replication protein"
FT                   /function="DNA replication"
FT                   /note="similar to Paracoccus versutus gi:18029507"
FT                   /db_xref="EnsemblGenomes-Gn:PHG373"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86122"
FT                   /db_xref="GOA:Q7WWW9"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWW9"
FT                   /protein_id="AAP86122.1"
FT                   /translation="MESASQQLALALFEDFAPRGQSVTEAPKDLGFRRSNAFVKIIDLS
FT                   LAGRRLIDVAYFLVAEDQEVRREYRVDVGLFKWLLATTSNNRRHLSKLVREAQKAAIEL
FT                   NEIDVEDPSKDRWGAVPLMGSAFIEKGEFIFELPERLQRAIKNPKSSHFLSLRYVFKSV
FT                   HSKVLYDRLQQFMVEGITPWFEVQALRAWLECEKKTYDLFKHFRSKVLEVAISEIREVT
FT                   GLHIEMLTLNVPGSKKIGQVRFRLNVTEQPNEQKTAFIVLRNVYETLRKEFALNQSEFN
FT                   EIITNRDLYNDERIHQAMEYTRHNVKVGKVKVRAGGYFMKALREGYLLGELDKQIHHQS
FT                   AIVESTRKAADQEMAEREARVKAAGAERDQREADFGWEAYNKLSTEQQSDMISEFCQSQ
FT                   AAKLLARRLNVAILNVHEYINDPNVRSTFGGFVASRVHKAAKAAKRVGAAASASLI"
FT   misc_feature    389001..392000
FT                   /note="AT-rich reion"
FT   gene            391125..392321
FT                   /gene="parA"
FT                   /locus_tag="PHG374"
FT   CDS_pept        391125..392321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="PHG374"
FT                   /product="putative partitioning protein"
FT                   /function="plasmid maintenance, partitioning"
FT                   /note="Pfam entry PF00991; similar to Burkholderia fungorum
FT                   gi:22990152"
FT                   /db_xref="EnsemblGenomes-Gn:PHG374"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86123"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWW8"
FT                   /protein_id="AAP86123.1"
FT                   /translation="MVVKSELTEIDRTVTIGSMSDFSKKLQKLTEELREHILAPRPRKS
FT                   PPTFTSTQVAEMCGIDRARLHYLATKDGSTLPAGELHGRVRQFTLGETRKWVQQASQVK
FT                   PSPLLRKGEADGRVLISANFKGGSCKTTSSMCLAQGLSLRGRKVLLVDLDPQASLTELC
FT                   GLYAEKMIVEESTVLPYIYSPEDFTLESVIQETYWDGVDVIPAHPSLFSAEFHIPAMAS
FT                   KSANYRFWTLLRKGLEPLRKKYDYIVLDSAPSLSYLTINGLMAADAMVMPLVPESLDFI
FT                   SSVSFWSLFSDMADSFKNIEGNKTYDFVSILLSKVDYGVASSAPIVRSWVQRAYGDWMS
FT                   PIEVPASSVMSNGALALATVFDISKFEGSNKTFQRVRIPFDEYCRWVDEFYAGKWEDA"
FT   gene            392322..393308
FT                   /gene="parB"
FT                   /locus_tag="PHG375"
FT   CDS_pept        392322..393308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="PHG375"
FT                   /product="putative partitioning protein"
FT                   /function="plasmid maintenance, partitioning"
FT                   /note="SMART domain SM00470; similar to Burkholderia
FT                   fungorum gi:22990151"
FT                   /db_xref="EnsemblGenomes-Gn:PHG375"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86124"
FT                   /db_xref="GOA:Q7WWW7"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWW7"
FT                   /protein_id="AAP86124.1"
FT                   /translation="MNMRKRMLEQTANLTPANEIKVEIAPQVADRPKTAPGMMAALSAA
FT                   QLRIQELESQGAASTVPVEKIRPNPWQPRIKFDESSLTELAESIKELGLMQPILVRRVT
FT                   PDNGESYFELIAGERRWRAHQVLGLQEIKALITDASDADMAVLALAENVSREDLTDYEI
FT                   GKAMRRAEKEFPDRKRMAESMGMSRSTLYRYFAFDNLPEFMRVDLEKNPSLFSGTAASD
FT                   TYAVLKKHGEPAVAAAREVWKQLVDGSLEQSKVAKLLEASLLRREATPVTSQRDIHKVY
FT                   AGKTQAGSITKDSVSFTVKLKSAVLTAAQEERIRTVINELFDGGPQR"
FT   gene            complement(395006..395611)
FT                   /gene="xerD"
FT                   /locus_tag="PHG376"
FT   CDS_pept        complement(395006..395611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="PHG376"
FT                   /product="putative integrase/recombinase"
FT                   /function="multimer resolution"
FT                   /note="Pfam entry PF00589; similar to Ralstonia
FT                   metallidurans gi:22980584; xerD family"
FT                   /db_xref="EnsemblGenomes-Gn:PHG376"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86125"
FT                   /db_xref="GOA:Q7WWW6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWW6"
FT                   /protein_id="AAP86125.1"
FT                   /translation="MGCSGARREEVARARRSHLKPVPEQAGIPDGLWELALLGKRGKWR
FT                   TVFLPPRVIEALRAHWADRGHDFEDVHQDLALLSPVSLPSTRTARSKHLTLREGLPVLS
FT                   GEGFSPDGLYRVLTTTLLRIAEDSTLPIDEAERHLLRKAAPHALRHTFATHAVANDIPT
FT                   DVLQRLLGHASLQTTSLYVRAERRRGIAAMAKLYSIQS"
FT   gene            398106..398531
FT                   /locus_tag="PHG377"
FT   CDS_pept        398106..398531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG377"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86126"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWW5"
FT                   /protein_id="AAP86126.1"
FT                   /translation="MEITDDVLAAANARGAAKKAAFPAVVSVRYDRRVSRVVIALASGL
FT                   ELAFSPKAAQGLEHAHPADLADAEISPSGLGIHFPHLDADLYLPALLEGFLGSKRWMAS
FT                   ELGKRGGAASTAAKAAAARENGRLGGRPRKSKLPAAA"
FT   gene            399309..399539
FT                   /locus_tag="PHG378"
FT   CDS_pept        399309..399539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG378"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86127"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWW4"
FT                   /protein_id="AAP86127.1"
FT                   /translation="MQRLQLVISPAHFVDRFGRRVLTNAGQPGMDGKEGVGSTTEEQRN
FT                   RVAAAIYANCEHLDNAQLDEIVAWVRLYRKK"
FT   gene            399671..399964
FT                   /locus_tag="PHG379"
FT   CDS_pept        399671..399964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG379"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86128"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWW3"
FT                   /protein_id="AAP86128.1"
FT                   /translation="MQRITEAVDCALCHMPASRWALRQSSDGYMYDCPACGGRYSIGTS
FT                   ALARAKNGEVPPGLLADVRHAIARGDIPRVGRTASEWHPLDVVGRQDADADL"
FT   gene            400859..401113
FT                   /gene="pemI"
FT                   /locus_tag="PHG380"
FT   CDS_pept        400859..401113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pemI"
FT                   /locus_tag="PHG380"
FT                   /product="putative PemI-like protein"
FT                   /function="plasmid maintenance postsegregational killing
FT                   mechanism"
FT                   /note="similar to Nostoc sp. pcc 7120 gi:17230704"
FT                   /db_xref="EnsemblGenomes-Gn:PHG380"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86129"
FT                   /db_xref="GOA:Q7WWW2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWW2"
FT                   /protein_id="AAP86129.1"
FT                   /translation="MRKSATLTIQKWGNSLAVRIPTAVARSAHFAEGQEVEVSVDEIGV
FT                   TVRPVGRRALTLAEKLALFDPIKHGGEAMATQRVGAEAM"
FT   gene            401113..401475
FT                   /gene="pemK"
FT                   /locus_tag="PHG381"
FT   CDS_pept        401113..401475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pemK"
FT                   /locus_tag="PHG381"
FT                   /product="putative PemK-like protein"
FT                   /function="plasmid maintenance, postsegregational killing
FT                   system"
FT                   /note="similar to Deinococcus radiodurans gi:15805444"
FT                   /db_xref="EnsemblGenomes-Gn:PHG381"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86130"
FT                   /db_xref="GOA:Q7WWW1"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWW1"
FT                   /protein_id="AAP86130.1"
FT                   /translation="MAGKLWAPERRDIIWIDCNPQAGREMKDMHPMLVLSPRPFNERTS
FT                   IVIGLPMTTAAYNETNPFAIKLQGPKGKDSYVLAHQPKSFDWRARNAKAHPWKQAPLEV
FT                   FAAACEQLNQIIAIAE"
FT   gene            complement(401394..401837)
FT                   /gene="nagM6"
FT                   /locus_tag="PHG382"
FT   CDS_pept        complement(401394..401837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagM6"
FT                   /locus_tag="PHG382"
FT                   /product="putative NagM-like protein"
FT                   /note="Pfam entry UPF0065; similar to Agrobacterium
FT                   tumefaciens gi:15890266"
FT                   /db_xref="EnsemblGenomes-Gn:PHG382"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86131"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWW0"
FT                   /protein_id="AAP86131.1"
FT                   /translation="MTSARGPRGATSPAHCPALATQAKAQLQKITYATPGIGTLLHLIG
FT                   VVLDKNSSVPLQHVPYKGAGSAINDLLGGQVDVLITSTSTVAGFIQSSRMCALAVTSLR
FT                   RLGVFAKTTRHAVKHGGYSAIAIIWFSCSQAAAKTSKGACFQG"
FT   gene            complement(402215..403453)
FT                   /gene="tutC"
FT                   /locus_tag="PHG383"
FT   CDS_pept        complement(402215..403453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tutC"
FT                   /locus_tag="PHG383"
FT                   /product="putative regulatory protein"
FT                   /note="SMART domains SM00091, SM00086 and SM00044; similar
FT                   to Nostoc sp. pcc 7120 gi:17228157; bZIP histidine kinase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PHG383"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86132"
FT                   /db_xref="GOA:Q7WWV9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWV9"
FT                   /protein_id="AAP86132.1"
FT                   /translation="MASISLVFPDSRQLRVRDVTLCTSDDFQTQRDKLARIMLDAMYQF
FT                   VGLLDVHGTMLEINRAALEAIGIRMDDIRGKPFWEARWWVVSPETQALLRELIQRASQG
FT                   EFVRCDFENYGQAEGEEKIIVDFSLLPIRDSNGNVVFLLPEGRNITEKKRAEAALALKN
FT                   EELQASWELIRRQRDELQSLYDRILAEQKLSERLLLNLLPYPIAERLKARPDLIASGVP
FT                   ELIADSFPEVTVLFADIVAFTRFSAGMSPEQLVAILNEIFTEFDTIAEVRGLEKIKTIG
FT                   DAYMAAAGLPEPAPDHAVRAAHMALNMSDALMHFNQHTGFNLQMRIGINSGAVVAGVIG
FT                   KRKFIYDLWGAAVNIASRMESHGVAGRVQVTDATRRLLGESFQFEERGSIEAKGIGALH
FT                   TWFLTGRNDAVFA"
FT   gene            complement(404461..404736)
FT                   /gene="mmlJ"
FT                   /locus_tag="PHG384"
FT   CDS_pept        complement(404461..404736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmlJ"
FT                   /locus_tag="PHG384"
FT                   /product="putative methylmuconolactone isomerase"
FT                   /function="degradation of aromatics"
FT                   /note="similar to Ralstonia eutropha gi:2808587"
FT                   /db_xref="EnsemblGenomes-Gn:PHG384"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86133"
FT                   /db_xref="GOA:Q7WWV8"
FT                   /db_xref="InterPro:IPR003464"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWV8"
FT                   /protein_id="AAP86133.1"
FT                   /translation="MLYCVQMDVKIPDSVPADRAEAIKAAEKARAIEIQQAGKWPHLWR
FT                   VAGRYANISIFDVECHDELHELLSSLPLFPYMTIQVTPLARHPSAI"
FT   gene            complement(404829..405170)
FT                   /gene="mmlI"
FT                   /locus_tag="PHG385"
FT   CDS_pept        complement(404829..405170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmlI"
FT                   /locus_tag="PHG385"
FT                   /product="putative 4-methylmuconolactone methylisomerase"
FT                   /function="degradation of aromatics"
FT                   /note="similar to Ralstonia eutropha gi:02808586"
FT                   /db_xref="EnsemblGenomes-Gn:PHG385"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86134"
FT                   /db_xref="GOA:Q7WWV7"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR018566"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWV7"
FT                   /protein_id="AAP86134.1"
FT                   /translation="MIRMLYLLVKPEGMTDEAFRAECLRHYEMSHDVPGLHRYEVRLVA
FT                   GQPTDTHVPFFDIGHVDAIGECWFENEADYDRYMASDIRKAWFEHGKTFIGRLKPFRTA
FT                   SVVGQSSAG"
FT   gene            complement(405241..406524)
FT                   /gene="mmlH"
FT                   /locus_tag="PHG386"
FT   CDS_pept        complement(405241..406524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmlH"
FT                   /locus_tag="PHG386"
FT                   /product="putative muconolactone transporter"
FT                   /function="muconolactone uptake"
FT                   /note="similar to Ralstonia eutropha gi:07387890; TC 2.A.1;
FT                   major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PHG386"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86135"
FT                   /db_xref="GOA:Q7WWV6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWV6"
FT                   /protein_id="AAP86135.1"
FT                   /translation="MLTWYKTGTPQQKKTFWACYSGWALDSFDMQMFSFLLPALTLAWG
FT                   LNKAEVGVLGTVALIVTAIGGWGAGILSDRYGRARILVFAIVWFTFFGVLAGFAQTYHQ
FT                   LLMARTLQGLGFGGEWAVGAALMAEVIDPKHRGKAMGYVQSGFALGWALAAVVATLLLA
FT                   WLPQDMAWRAAFWIGIIPASIVLFIRRHIKDAPMFERARQSSAPRASLASVFNRRYARS
FT                   LILSSVLVIGLQAGCYAILVWLPSLLSQREVAATSRIVTVFIMAFGSFCGFAVAADLCD
FT                   RIGRRPTLIMLSICAWIVTVSYMLLPLNPTLTAILGFLVGFSAIGMFAALGPFLSELFP
FT                   TNVRTTCMGFAYNVGKSVGAGSVVGVGVLSTHIGLANAMGAFCLAAYAFAVFGMLLLPE
FT                   TRGIVIENIGTEDDGDTVTIANPARAPS"
FT   gene            complement(406613..407275)
FT                   /gene="catJ"
FT                   /locus_tag="PHG387"
FT   CDS_pept        complement(406613..407275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catJ"
FT                   /locus_tag="PHG387"
FT                   /product="oxoadipate CoA transferase beta subunit"
FT                   /function="degradation of aromatics"
FT                   /note="Pfam entry PF01144; similar to Pseudomonas putida
FT                   kt2440 gi:26990657"
FT                   /db_xref="EnsemblGenomes-Gn:PHG387"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86136"
FT                   /db_xref="GOA:Q7WWV5"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWV5"
FT                   /protein_id="AAP86136.1"
FT                   /translation="MDQLARNMLAARVARDIPDGSYVNLGIGLPTLVANHLPRHREVIL
FT                   HSENGVLGQWSAAEPGQEDWDLINAGKEAIRLEQGAAFFHHADAFGMMRGGHLDICVLG
FT                   AFQVSEQGDLANWHTGAPDAIPAVGGAMDLAIGARRVFVMMDHLTRDGASKLRRQCSYP
FT                   LTGLRCVNRVYTELGTFAIGPRGVSVIEAVGDMSPQALQSVTDVELDFTTLLRPEYA"
FT   gene            complement(407281..407979)
FT                   /gene="catI"
FT                   /locus_tag="PHG388"
FT   CDS_pept        complement(407281..407979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catI"
FT                   /locus_tag="PHG388"
FT                   /product="oxoadipate CoA transferase alpha subunit"
FT                   /function="degradation of aromatics"
FT                   /note="Pfam entry PF01144; similar to Ralstonia
FT                   solanacearum gi:17546973"
FT                   /db_xref="EnsemblGenomes-Gn:PHG388"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86137"
FT                   /db_xref="GOA:Q7WWV4"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWV4"
FT                   /protein_id="AAP86137.1"
FT                   /translation="MIDKLYRTAREAMDDVPDGATIAIGGFGGAGMPDELIDALIEQGA
FT                   KDLTVVSNNAGNGDTGLAALLKARRVRKLVCSFPRQRDAYVFEELYRAGQIELEVVPQG
FT                   TLAERLRAAGSGIGAFYTPTGYGTLLAEGKETRQIDGRGYVLEYPLPVDVALINAAAAD
FT                   RWGNLIYNKTARNFAPVMAMAASQTIAAVARVCELGELDPEDVVTPGIFVSRVVLRDGA
FT                   VAQAEVMQAG"
FT   gene            complement(408233..409147)
FT                   /locus_tag="PHG389"
FT   CDS_pept        complement(408233..409147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG389"
FT                   /product="putative regulatory protein"
FT                   /note="Pfam entries PF00126 and PF03466; similar to
FT                   Salmonella typhimurium lt2 gi:16764221; LysR-type"
FT                   /db_xref="EnsemblGenomes-Gn:PHG389"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86138"
FT                   /db_xref="GOA:Q7WWV3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWV3"
FT                   /protein_id="AAP86138.1"
FT                   /translation="MAVPFDITDFRLFVNVAETRSLTRGAERSFLSVPAVSNRIKNLED
FT                   TLGVRLLERSPQGVALTAAGEVYLQHARVVLAELERLTGNLQPFTAGLSGQLKLVANTT
FT                   AITEYLPPVIGDYLASHPDVRIDVRERLSDDIVRLVREGATDLGIISGNVPTAGLQAVP
FT                   FVKSALILVAPLGHPLLAQREVWFEQSLEYAFVALLEGSAFQMFMTRAAGALHKPMTIR
FT                   VHVASYDAICRMVAAGAGIAIMPKAAFARLKGEQPIGACNLRDDWAIRTFQVCARDLEG
FT                   LSSFAREFANRLIGRYAPGGSAG"
FT   gene            complement(409246..410136)
FT                   /locus_tag="PHG390"
FT   CDS_pept        complement(409246..410136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG390"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Streptomyces coelicolor a3(2)
FT                   gi:21225070; metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PHG390"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86139"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWV2"
FT                   /protein_id="AAP86139.1"
FT                   /translation="MMQSRTLGDLKVTRILEYAGPTHDPAFLFPDIDRAVLDANADLMA
FT                   PHHWIPHMNKLIVTIQFWVVHAGDNIIVVDTGVGNFKPRAGIARMNMLNTLVREWMIAA
FT                   GAPPEKVTHVVMTHLHADHVGWNTTWQDNRWVPTFPNARYYIPKDDFDFCDEGRNKEPG
FT                   VVDVFGESFFDSVMPVVTEGLAEMILPGQEIANCLQVEPASGHSPGQVVFRVRSRGEEA
FT                   IFCGDILHSPLQIVRPDVNSGYCIRPDLARSTRLAFLNQAADRESLVLPVHFGEPYCGY
FT                   VRRQGEGFRFEPATW"
FT   gene            410486..410614
FT                   /locus_tag="PHG391"
FT   CDS_pept        410486..410614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG391"
FT                   /product="reverse transcriptase"
FT                   /note="similar to Incl/m plasmid r471a gi:02688957"
FT                   /db_xref="EnsemblGenomes-Gn:PHG391"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86140"
FT                   /db_xref="GOA:Q7WWV1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWV1"
FT                   /protein_id="AAP86140.1"
FT                   /translation="MTSAKRMRSKLVAVKEQLRRRMHQTIAEQERYLSAMVIRHVR"
FT   gene            complement(410959..411966)
FT                   /gene="nagM4"
FT                   /locus_tag="PHG392"
FT   CDS_pept        complement(410959..411966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagM4"
FT                   /locus_tag="PHG392"
FT                   /product="putative NagM-like protein"
FT                   /note="Pfam entry UPF0065; similar to Ralstonia
FT                   metallidurans gi:22976733"
FT                   /db_xref="EnsemblGenomes-Gn:PHG392"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86141"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWV0"
FT                   /protein_id="AAP86141.1"
FT                   /translation="MKTLFQLRGNTGRAGTVALATGLSFALAFATAAAHAAYPDRAIRW
FT                   VVPFPAGGAIDNIARTLGDDMSRTLGQPVVVENRPGAGGNIGAEMVARSPADGYTMIIV
FT                   GNGMSVNSELYGQLTYDPVKDFAPVSLLAVVPNVLVVNKNRRQEGTVKEVIAHAKASPG
FT                   KYTYASAGNGTSIHLAAALFNSMAGIDMLHIPYKGSGPAMSDMLGGQVDYMFDSITSAK
FT                   PQIDAGKLRAIAVTTAKRSSALLNVPTVAEAGLPGYELSPWFAAFVPAKTPQPVIESLN
FT                   RAMLEALKKPEVQKRLALIGAEPIGSTPSALRDHLAKESQKWGVLIRERGIRAD"
FT   gene            complement(412022..412129)
FT                   /locus_tag="PHG393"
FT   CDS_pept        complement(412022..412129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG393"
FT                   /product="putative muconolactone isomerase"
FT                   /function="degradation of aromatics"
FT                   /note="similar to Ralstonia eutropha gi:11967280"
FT                   /db_xref="EnsemblGenomes-Gn:PHG393"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86142"
FT                   /db_xref="GOA:Q7WWU9"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWU9"
FT                   /protein_id="AAP86142.1"
FT                   /translation="MESNEALHTLLSALPLVPYTKIRATPLAKHPSSIR"
FT   gene            complement(412344..413462)
FT                   /gene="catB2"
FT                   /locus_tag="PHG394"
FT   CDS_pept        complement(412344..413462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catB2"
FT                   /locus_tag="PHG394"
FT                   /product="putative muconate cycloisomerase"
FT                   /function="degradation of aromatics"
FT                   /note="similar to Ralstonia eutropha gi:11967279"
FT                   /db_xref="EnsemblGenomes-Gn:PHG394"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86143"
FT                   /db_xref="GOA:Q7WWU8"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR013370"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWU8"
FT                   /protein_id="AAP86143.1"
FT                   /translation="MKATIQSIEAILVDLPTIRAHQLAMATMQQQTLVIVRLRCCDGIE
FT                   GIGEATTIGGLSYGDESPEGIKLTIDTYLAPALAGQDATNVHAAMTRLNKVARGNRFAK
FT                   SALETALLDAQGKRLGVPLATLLGGKVRDTLPVLWTLASGDTARDIEEAERLLAERRHN
FT                   TFKLKIGRRSVRDDVAHVSGIKRALGDRACVTVDVNQAWNEADAATGIAALEAAGIDLI
FT                   EQPTPREQRTALARLAARFIVPIMADEAVCGPEDAMDLARLGAADVFALKIAKSGGIFG
FT                   MLRTAAVGDAAGIALYGGTMLEGTVGTIAAAHGFCTLPQLAWGTELLGPLLVKDDIVVK
FT                   RPEYRDFRLHLPEGPGLGLTIDEAKLAHYRRA"
FT   gene            complement(413665..414642)
FT                   /locus_tag="PHG395"
FT   CDS_pept        complement(413665..414642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG395"
FT                   /product="putative 2-nitropropane dioxygenase"
FT                   /note="Pfam entry PF03060; similar to Ralstonia
FT                   solanacearum gi:17544974"
FT                   /db_xref="EnsemblGenomes-Gn:PHG395"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86144"
FT                   /db_xref="GOA:Q7WWU7"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWU7"
FT                   /protein_id="AAP86144.1"
FT                   /translation="MATAPHLPPILQNLTLPVISSPMFTVSYPELVLAQCKAGIVGSFP
FT                   ALNARQPELLDEWLTLMREELDTFRAANPGAIVGPLAVNQIAHTSNVRLEQDVATCVRH
FT                   RVPIFITSLRAPVREIVEAVHSYGGIIFHDVVNLRHAEKALEAGVDGLILVAAGAGGHA
FT                   GTLSPMALVGEVRRRFNGPIALSGAIATGDAILAAQAMGADFAYIGTRFIASEEANASP
FT                   DYKQSLIKAGASDIVYSNLFSGVHGNYVRESIERIGLDPDNLREGEKSKMSFADGRSKP
FT                   KAWKDIWGAGHGVAQIHDIPTTSEIVRRLSREYVAARDRIARLP"
FT   gene            complement(414676..415653)
FT                   /gene="nagM3"
FT                   /locus_tag="PHG396"
FT   CDS_pept        complement(414676..415653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagM3"
FT                   /locus_tag="PHG396"
FT                   /product="putative NagM-like protein"
FT                   /note="Pfam entry UPF0065; similar to Ralstonia
FT                   metallidurans gi:22977461"
FT                   /db_xref="EnsemblGenomes-Gn:PHG396"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86145"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWU6"
FT                   /protein_id="AAP86145.1"
FT                   /translation="MQSLIRLTGMLVALTVAGTAAAQSFPSKPVTIVVPYSAGGPVDSF
FT                   VRGLTPRLADAWKQPVVVLNKPGANEIIGAEFVAKSAPDGYTLFAGTEAALTMNQFLYK
FT                   KLPYSPDKDFAEVSRLVALPLVFFVPKTSPANSLKEFIALAKKVSASKPMTYGSSGAGG
FT                   IAHLPMAMFTHNENLTMVHVPYKGAAPLIPEVISGQIDAAVLGVSVIEQHVKSGALKAL
FT                   AVSADTRSAALPDVPTFKELGIKEINAVFNIGLVAPHGTPTALVEKISSDVSRIVQSPD
FT                   FRRKYIDAFSYVAVGSTPAAFKDFLAQDRRIQSERVKLSGVSLD"
FT   gene            complement(415783..416244)
FT                   /locus_tag="PHG397"
FT   CDS_pept        complement(415783..416244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG397"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam entry PF01575; similar to Archaeoglobus
FT                   fulgidus gi:11499894; MaoC family"
FT                   /db_xref="EnsemblGenomes-Gn:PHG397"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86146"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWU5"
FT                   /protein_id="AAP86146.1"
FT                   /translation="MPTTLYFEDFLRGQVFESTGRTITETDLTMFSMLSGDWNPIHADA
FT                   EFARGTRFGQRVVHGALGIALATGMLHQLGVFDKSAVAMMSLQNWTFAAPIFVGQTLRL
FT                   RMEILETEAGTSKRVGRVNRRLQLIDQTGGVIQDGTTDVLVLKRDAQAA"
FT   gene            complement(416265..417872)
FT                   /gene="fadD2"
FT                   /locus_tag="PHG398"
FT   CDS_pept        complement(416265..417872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD2"
FT                   /locus_tag="PHG398"
FT                   /product="putative long-chain-fatty-acid-CoA ligase"
FT                   /note="Pfam entry PF00501; similar to Methanothermobacter
FT                   thermautotrophicus gi:15678684"
FT                   /db_xref="EnsemblGenomes-Gn:PHG398"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86147"
FT                   /db_xref="GOA:Q7WWU4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWU4"
FT                   /protein_id="AAP86147.1"
FT                   /translation="MKTNLWSLIDAHLAEHPDAVAFIEGERAITHAEFDQLCRRTVAWL
FT                   DAQGIGKGDRVGVWLVNRIEWLALFFALARVGATLVSVNTRYRSEEVSYLIEKSGARLL
FT                   VLQPGFRKIDFSRILDAMDPASLPTLQAIAVVDASPATPARLLGRPVVPFDLHLREPVQ
FT                   GLDESDPNACAILFTTSGTTKGPKLVMHPQRTLVDHAWRCADAYGMDADGAVMLAMLPF
FT                   CGVFGLNGVLAAFAGGAPVVLLETFEGPQAARLLADQRVTHTFGSDEMYRRILDTAPAD
FT                   RPFPAARLFGFGAFTSSFSEYASEACVRGIPLAGLYGSSEVLALFSCQPMTLPAQARIE
FT                   GGGLPVARGEATVRIRDVQTGALLPAGQSGEIEISAPSLFLGYDHDQDATAEAIRPDGF
FT                   FRTGDLGHLRADGTFVYETRMGDAIRLGGFLVNPVEIEAVLKRFEGVADAQVVAVEIDG
FT                   QTRVVAFLILTDGTRLAEADVMAQMRAQVAPFKVPARVWFVDAYPVTLSSNGVKTQRNR
FT                   LRDLALARLAEPVPAAGA"
FT   gene            complement(417947..419482)
FT                   /gene="fadD1"
FT                   /locus_tag="PHG399"
FT   CDS_pept        complement(417947..419482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD1"
FT                   /locus_tag="PHG399"
FT                   /product="putative long-chain-fatty-acid-CoA ligase"
FT                   /note="Pfam entry PF00501; similar to Mycobacterium
FT                   tuberculosis h37rv gi:15607355"
FT                   /db_xref="EnsemblGenomes-Gn:PHG399"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86148"
FT                   /db_xref="GOA:Q7WWU3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWU3"
FT                   /protein_id="AAP86148.1"
FT                   /translation="MVASLQYGEARFDGAEIERRAAQVAGGLAALGVGEDDVVAIVLRN
FT                   APALFEITLACNRVGAYHCPVDWRFTVDELGYILQDSGACVLFIEADLLATLRAAIPEG
FT                   VRVLAVTPEPLALQAYPTSRVTGEVPADVLRYEAWRSAQAAYSGPSHRPRGRFAYTSGT
FT                   TGRPKGVRRLAQGLHPEQPRLLRDTVKAVFDFSADARVYLSAPLYHGAPNLYGMQAMLA
FT                   TGLVVLDPRFDAEATLRAIERHRITHLYLVPTMCVRLLALPQHVRNRYDLSSVRFVACT
FT                   GAPFAVAIKQAMINWWGPVINESYACSEMGMITVISSADAIRKPGSVGRPVSEAEVRIY
FT                   SDAGCRLGTGGVGNIHVRQPAYADFTYHNRPEARAAMDCEGLACVGDMGYVDADGFLFI
FT                   CDRKADMVISGGVNIYPAEIEDALSGMPGVADCAAFGVPHEEFGEMVVAVVQPSDGTGL
FT                   DPEEMRAWLKDRLAAYKVPKVIELRTELPRQESGKIHKRKLRDGYWQHAGRRI"
FT   gene            complement(419510..420463)
FT                   /gene="nagM2"
FT                   /locus_tag="PHG400"
FT   CDS_pept        complement(419510..420463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagM2"
FT                   /locus_tag="PHG400"
FT                   /product="putative NagM-like protein"
FT                   /function="degradation of aromatics"
FT                   /note="Pfam entry UPF0065; similar to Bradyrhizobium
FT                   japonicum gi:27382172"
FT                   /db_xref="EnsemblGenomes-Gn:PHG400"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86149"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWU2"
FT                   /protein_id="AAP86149.1"
FT                   /translation="MKRIIPALLLCSATIATNAQAEYPVRPITLVVPFPAGATTDTVAR
FT                   VVGQAASAQLGQPIVIDNKPGAEGQVAAQEVARATPDGYRLLLATSGNLSLVPALRKKP
FT                   PYDVLTDFTPIADVGRFGFFLYVNPAVPASNLNEFLAYAKANPGKLSYGTGNNTGVVAF
FT                   SHFKTLTGIELTQVPYKGEPPAMLDLIAGRTQAMIGTTIGASYLREGKLRALVSINAQR
FT                   NSLLPDVPTLREAGMQDLEIMPWAGLVGPAGMPKDVVARLNQAFVAAMNNPKVREQMDR
FT                   LGFPLTPSSPEAFGRLIKHQLAVHGRLVKDAGLQPE"
FT   gene            420589..421515
FT                   /locus_tag="PHG401"
FT   CDS_pept        420589..421515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG401"
FT                   /product="putative regulatory protein"
FT                   /note="LysR-type; Pfam entries PF00126, PF03466 and
FT                   PF01047; similar to Ralstonia metallidurans gi:22978581"
FT                   /db_xref="EnsemblGenomes-Gn:PHG401"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86150"
FT                   /db_xref="GOA:Q7WWU1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWU1"
FT                   /protein_id="AAP86150.1"
FT                   /translation="MELDAYLFFATVVESGSFMNASLKLGIDRSNVSRRIRKLERDVEA
FT                   QLVRRSTRRMSLTEIGEAFYAQCAVIRAEVERADELLHTFGTSIRGPLRVSCPPAVGRL
FT                   YLTAMFAEFCNLYPKVSLSVSFKGGAVDLMENDLDLALRVTNDPGEHCVARALGPIEWM
FT                   LCANPEYLERHGRPVTPEDLASHTCLGVRTRVGLEYVREGSDLVHRVSIQPHLECSDYG
FT                   FLGEMAAAKLGIGLLPSYVAVEHLQSGRLETVLNEYRLTRSPGSTLYAITLPNRYTPPQ
FT                   LRAFIDFLKSRFEQGLPWEKDLMRTGA"
FT   gene            complement(421891..422904)
FT                   /gene="nagM5"
FT                   /locus_tag="PHG402"
FT   CDS_pept        complement(421891..422904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagM5"
FT                   /locus_tag="PHG402"
FT                   /product="putative NagM-like protein"
FT                   /note="Pfam entry UPF0065; similar to Ralstonia
FT                   metallidurans gi:22976057"
FT                   /db_xref="EnsemblGenomes-Gn:PHG402"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86151"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWU0"
FT                   /protein_id="AAP86151.1"
FT                   /translation="MKQGLEMLRLAIARLVLATAGMTWAVGVVALAEPGAALAAYPDKP
FT                   IRLIVPAAAGGTTDIASRLVGKRMAELLGQPVVVENRAGGAGIIGVQALKQSAPDGYTL
FT                   MMGNIGPNAINYSLYRQLPYRAEDFAPVTMVVSVPNVLVVNANVPARTVAQLVALSKAQ
FT                   PGKLSFASSGTGQSVHLSGELFRKRTGIDIIHVPYKGAAPAVADLVAGQVTMMVDNLPS
FT                   SLPHIQSGKLRALAVTSASRVPELPDVPTMKEAGLEDFQVTAWFGLMAPAGTPSAVIDR
FT                   LQRTVAIILAEPEVKSRLADFGGVPGGDTPTHFGNFIKSERERWARVVKDTGIPLE"
FT   gene            complement(423506..424519)
FT                   /gene="nagM1"
FT                   /locus_tag="PHG403"
FT   CDS_pept        complement(423506..424519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagM1"
FT                   /locus_tag="PHG403"
FT                   /product="putative NagM-like protein"
FT                   /note="Pfam entry UPF0065;similar to Ralstonia
FT                   metallidurans gi:22976733"
FT                   /db_xref="EnsemblGenomes-Gn:PHG403"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86152"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWT9"
FT                   /protein_id="AAP86152.1"
FT                   /translation="MKSLLQRLFPRPLTTPDARTGAAALMLVLAAASAPAHAAWPDHPI
FT                   RWIVPFPAGGAMDNIARTLGEDMSRTLGQAIVVENRPGAGGNIGAELVARAPADGYTMI
FT                   IVANGMAVNPALYGKLGYDPVKDFAPVSLLAVVPNVLVASKAKTPVKTVAEVVANAKAR
FT                   PGKYTYASAGNGTSIHLAGELFTSMAGVDLLHVPYKGSGPAMTDLLGGQVDYMFDSITS
FT                   AKPHIDSGKLTAIAVTTTKRSTALPNVPTVAESGLAGYELSPWFAAFVPARTPSAAIEK
FT                   LNQAMLDALRNPAVQKRLAAIGAEPIGSTPAALRDHLARETAKWGELIRARGIRAD"
FT   gene            complement(424548..424826)
FT                   /gene="catC"
FT                   /locus_tag="PHG404"
FT   CDS_pept        complement(424548..424826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catC"
FT                   /locus_tag="PHG404"
FT                   /product="putative muconolactone isomerase"
FT                   /function="degradation of aromatics"
FT                   /note="similar to Ralstonia eutropha gi:11967280"
FT                   /db_xref="EnsemblGenomes-Gn:PHG404"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86153"
FT                   /db_xref="GOA:Q7WWT8"
FT                   /db_xref="InterPro:IPR003464"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWT8"
FT                   /protein_id="AAP86153.1"
FT                   /translation="MLYLVRMDVNLPHDMPAAQADEIKAREKAYAQDLQRQGKWQQLYR
FT                   VVGEYANYSIFDVESNDKLHTLLAGLPLFPYMKLAVTPLAKHPSSIR"
FT   gene            complement(424862..425989)
FT                   /gene="catB1"
FT                   /locus_tag="PHG405"
FT   CDS_pept        complement(424862..425989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catB1"
FT                   /locus_tag="PHG405"
FT                   /product="putative muconate cycloisomerase"
FT                   /function="degradation of aromatics"
FT                   /note="similar to Ralstonia eutropha gi:11967279"
FT                   /db_xref="EnsemblGenomes-Gn:PHG405"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86154"
FT                   /db_xref="GOA:Q7WWT7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR013370"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWT7"
FT                   /protein_id="AAP86154.1"
FT                   /translation="MTHVTVTAVEAILVDLPTIRAHQLAMATMQQQTLVIVRLQCSDGI
FT                   EGIGEATTIGGLSYGDESPEGIKLTIDTYLAPALVGQDAANVHAAMARLNKVARGNRFA
FT                   KSALETALLDAQGKRLGVPLITLLGGAVRDTLPALWTLASGDTGRDIAEAEQLLEARRH
FT                   NTFKLKIGRRAVRDDVAHVAAIKRALGDRARVTVDVNQAWNEAEAATGIAMLEAAGIDL
FT                   IEQPTPREQRAALARLAARFVVPIMADEAVCGPEDAMELARIGGADVFALKIAKSGGIF
FT                   GMLRTAAVGDAAGIALYGGTMLEGSVGTIAAAHGFCTLPQLAWGTELFGPLLLKDDIVT
FT                   ARPEYRDFALHLPQGPGLGLALDEDKLAHYRRKQG"
FT   gene            426155..426319
FT                   /locus_tag="PHG406"
FT   CDS_pept        426155..426319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG406"
FT                   /product="putative regulatory protein"
FT                   /note="LysR-type; similar to Burkholderia sp. nk8
FT                   gi:12539416"
FT                   /db_xref="EnsemblGenomes-Gn:PHG406"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86155"
FT                   /db_xref="GOA:Q7WWT6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWT6"
FT                   /protein_id="AAP86155.1"
FT                   /translation="MTRAASILHMAQPPLSRQIRQFEDEIGVDLFHRVGRGMRLLQIAN
FT                   TPSGSRYIR"
FT   gene            426494..428119
FT                   /gene="tniA"
FT                   /locus_tag="PHG407"
FT   CDS_pept        426494..428119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tniA"
FT                   /locus_tag="PHG407"
FT                   /product="putative TniA-like transposition protein"
FT                   /note="similar to plasmid r100 gi:09507558; Tn21 family"
FT                   /db_xref="EnsemblGenomes-Gn:PHG407"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86156"
FT                   /db_xref="GOA:Q7WWT5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWT5"
FT                   /protein_id="AAP86156.1"
FT                   /translation="MRIATKRELAIARVLRPLGRAPLSRRQAENAGKLLGIHWATVYHL
FT                   RRRFLADPVASALIPYERGPKVGDTRLAATVEEIVREVLSDWLPRQPYLAHPLFELVVE
FT                   IRKRCAAASISPPSRSTISRRWRAHREEEALRLATLPGSEIPPGHLVARCPMDIVQIDH
FT                   TLADLMLVDDASRRPIGRPWLSIALDVSTRCVVGVYVGMDRPNAATVALLLTRVVLPKD
FT                   GWLASLDVSVDWPMHGIPQLLHLDNAAEFKSRALRAGCREYGVELMYRPAGRPYFGGHI
FT                   ERLMRTIMERVHSLPGSTGSSPKGRKARPPEKEASLTIREFERWLVLEIAERYHHNAHR
FT                   GLQGATPFSQWATAGQKTPPRLLPNAAPEPLRFLIQFLPMTYRTVQSDGLTLFYLRYWH
FT                   PIFAAWRATKQKVITRYHPEDLSRIFVSVDGKHYVEATFADLRRGRVSLWEQRSALRRL
FT                   RSQGKEYVTEAKVFDAIDEQRRIVSHARSQTLGANRQGEALKELSPQSLGEAPNSVRAN
FT                   TLDKQSEPAVDYNKPPPVFNVEPL"
FT   gene            428125..428994
FT                   /gene="tniB"
FT                   /locus_tag="PHG408"
FT   CDS_pept        428125..428994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tniB"
FT                   /locus_tag="PHG408"
FT                   /product="putative TniB-like transposition protein"
FT                   /note="similar to Ralstonia metallidurans gi:22979812; Tn21
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PHG408"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86157"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWT4"
FT                   /protein_id="AAP86157.1"
FT                   /translation="MRPLLTHLLPAARELAMCDDGVRIKGLARSHWIDYPRATQALEIL
FT                   ERLLQTPQRERMPCLLLHGDSNIGKTQIVSKFQRRHPPEYDEGKGVELRSIVAMQMPPT
FT                   PEQPRFYSSLLFELGAPFNAAARLSALENLSRALLRKVSARMLIVDEVHHLLAGNYREQ
FT                   RASLNLLKFLANDLKIAVVLVGTQDAVLALQTDPQMVSRFARFEVPRWQETEAFRSLLA
FT                   AFEMILPLRRPSNLARREIVHAILTASGGLTGEVSRVLTVSAELAIRDGKEAIDLGHIE
FT                   NAARTLLS"
FT   gene            428969..429475
FT                   /gene="tniQ"
FT                   /locus_tag="PHG409"
FT   CDS_pept        428969..429475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tniQ"
FT                   /locus_tag="PHG409"
FT                   /product="putative TniQ-like transposition protein"
FT                   /note="Tn21 family"
FT                   /db_xref="EnsemblGenomes-Gn:PHG409"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86158"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWT3"
FT                   /protein_id="AAP86158.1"
FT                   /translation="MQREPCSPEGVRPWPVAPRPFDDEAFGGWLGRLAARYQISVDQLW
FT                   QIGDLGAFPALTNSGWLLFPPMDEQALCRLAMLTHIGMPRLEALQTPMAWVSDRDQLPY
FT                   CFDCLVLNPVDVFSPRWKRDWLDPHTAVCQVPGHRLNSLPPCTLRICRNLTAVLRAISK
FT                   RQRKG"
FT   gene            429511..429798
FT                   /locus_tag="PHG410"
FT   CDS_pept        429511..429798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG410"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86159"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWT2"
FT                   /protein_id="AAP86159.1"
FT                   /translation="MTTIGGNNDLQHLDNNRHFIVNYGDRFRHGEPIASGFVESAVNQV
FT                   VSKRFVKRQQMAWRPRHAHNLLQIRTAVLNNHLRSYVERWYPSIVGELAA"
FT   gene            429848..431014
FT                   /gene="tnpA"
FT                   /locus_tag="PHG411"
FT   CDS_pept        429848..431014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PHG411"
FT                   /product="truncated transposase"
FT                   /note="similar to Ralstonia metallidurans gi:22980875;
FT                   incomplete IS882-like element"
FT                   /db_xref="EnsemblGenomes-Gn:PHG411"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86160"
FT                   /db_xref="GOA:Q7WWT1"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWT1"
FT                   /protein_id="AAP86160.1"
FT                   /translation="MAELLSTYAALLAHGTEIDAKGIAAMIPGIDAAQVSLAMRGLETH
FT                   GRLRRANEVVAEFQGKIPLATHWGTGNKASADMMSLDVSRHLWIARVDPRRRTYATGIY
FT                   THVLDKWGIVYDQPIVLNERQAGVAIEGVEQHNRSEDRIRLSLLAVDTHGYTNAALALA
FT                   KGLNFDLCPRLRDLAERKLYLPAAFKVPEGIERVTTKRLSLRAIRLGWDDFLRVLASIR
FT                   IGRISAELAMQRLGSAARTNKAHKAAEHLGRLLRSIFLCDYVTIEDFRREIHTLLSRGE
FT                   SVHQLQRAIHAGRVPHERGRRGDEMTAISGAHALLTNIVLAWNTHRMNDVVERLRKGGT
FT                   NIEDAWLRRMGPGHFGHINFRGILSFGVERYIDALIQGRRATIRQAMA"
FT   mobile_element  432268..433691
FT                   /mobile_element_type="insertion sequence:IS884"
FT                   /function="transposition"
FT                   /note="member of the IS110 family"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   repeat_region   432268..432280
FT                   /rpt_type=INVERTED
FT                   /note="IS884 terminal IR"
FT   gene            432393..433412
FT                   /gene="tnpA"
FT                   /locus_tag="PHG412"
FT   CDS_pept        432393..433412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PHG412"
FT                   /product="putative transposase"
FT                   /note="similar to Caulobacter crescentus cb15 gi:16126973"
FT                   /db_xref="EnsemblGenomes-Gn:PHG412"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86161"
FT                   /db_xref="GOA:Q7WWT0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWT0"
FT                   /protein_id="AAP86161.1"
FT                   /translation="MNSMAVGVDIAKTVFQVHYIDQATGEIVNKQIKRAKFLEHFANRA
FT                   PCLIGMEACGGAHHWARQLTKMGHQVRLMPAEFVKAFNIRNKNDAADARAIWLAVQQPS
FT                   KAVAVKTEMQQAMLALHRMREQLVKFRTMQINALRGLLTEYGEVMGKGRTALDKAIPEV
FT                   LARVAERLPAALVETLREQWSGLTKLDEQIAGIERRMRDWVKEDKAVKAISEIPGVGLL
FT                   TATATVAMMGDAKTFRSGREFAAWAGLVPKQTGSGGKVNLHGISKRGDTYLRTLLIHGA
FT                   RSVVTRAKDPGPWVEQMTKRRPLNVVVVALANKMARMIWAILAHDRPYQKDYISVKPA"
FT   repeat_region   432679..432691
FT                   /rpt_type=INVERTED
FT                   /note="IS884 terminal IR"
FT   gene            433731..433970
FT                   /locus_tag="PHG413"
FT   CDS_pept        433731..433970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PHG413"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86162"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWS9"
FT                   /protein_id="AAP86162.1"
FT                   /translation="MNYGDRYRHGEPIASGFVESAVNQVVSKRFVKRQQMAWRPRHAHN
FT                   LLQIRTAVLNDQLRSYVERWYPSIAGEENHRLAA"
FT   gene            complement(434219..435598)
FT                   /locus_tag="PHG414"
FT   CDS_pept        complement(434219..435598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PHG414"
FT                   /product="putative NADH dehydrogenase"
FT                   /note="Pfam entry PF00070; similar to Bradyrhizobium
FT                   japonicum gi:27378838"
FT                   /db_xref="EnsemblGenomes-Gn:PHG414"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86163"
FT                   /db_xref="GOA:Q7WWS8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWS8"
FT                   /protein_id="AAP86163.1"
FT                   /translation="MKVISSPHELLHQFRGRRDSVPADSQHQIVIVGGGAGGLELATAL
FT                   GNKLGKRGLAAVTLIDKTRSHIWKPKLHEIAAGSMDMNVHEVEFLAQSHWHHFTYRVGE
FT                   MIGLDRERQEVEVAAFIDDEGHQVTPQRRFRYDTLVIAVGSQSNDFGTPGVSENALKLE
FT                   SPADARRFNQRLVNACIRAHAQPAPLEPHQLQVAIIGAGATDVELAAELHRTTRALVAY
FT                   GLDRIDPEKDIRLNLIEAADRVLPALPARLSAATEVLLRKLGVELHTSSRVAEVLPQGV
FT                   QLADGRIIAAELVVWAAGVKAPEHLKELAGLETNRINQLVVRQTLQTTLDDNIFALGDC
FT                   AACPWPEKNSIVPPRAQAAHQQASHIVGQVLRRLRGKPLRQYRYRDFGSLVSLGEYSTV
FT                   GNMMGGLSGGNLMIEGSFARLMYLSLYKMHELALHGFPKVALDTLARLITRRTEPHVKL
FT                   H"
FT   repeat_region   436316..436317
FT                   /rpt_type=DIRECT
FT                   /note="target site duplication"
FT   mobile_element  complement(436318..437417)
FT                   /mobile_element_type="insertion sequence:IS885"
FT                   /note="member of the IS630 family"
FT   repeat_region   complement(436318..436341)
FT                   /rpt_type=INVERTED
FT                   /note="IS885 terminal IR"
FT   gene            complement(436339..437373)
FT                   /gene="tnpA"
FT                   /locus_tag="PHG415"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(436339..437373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PHG415"
FT                   /product="putative transposase of IS885"
FT                   /function="transposition"
FT                   /note="similar to Xanthomonas oryzae pv. oryzae
FT                   gi:28173597"
FT                   /db_xref="EnsemblGenomes-Gn:PHG415"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86164"
FT                   /db_xref="GOA:Q7WWS7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WWS7"
FT                   /protein_id="AAP86164.1"
FT                   /translation="MKCKRNSDGRAIDHHALQVMRQQAIKAVREGQTAQSVAAALGVNV
FT                   RSVFRWLADYASGGQRALLAKPIPGRPSKVSGDEMRWLAQAVRDNTPQQYKFEFGLWTL
FT                   SLIRALIHRQFGKELSLSAVSRVMKLLGFSAQKPLYQAWQQDAMLVRRWEAEIYPAIRA
FT                   EAREVGARIYFADESGIRSDYHTGTTWAPRGQTPVVEATGRRFSLNMISAVSPQGEFRF
FT                   MLHDGAVTGTVFCEFLQRLMVGADKPVFVVVDGHPIHKAKLVKAYIASLKGQLKLFYLP
FT                   PYSPHLNPDEQVWAHVKRQVSKRLVQDKNDMKKLALGALRRIQKLPSLVKSFFCQPECK
FT                   YAAM"
FT   repeat_region   complement(436394..437417)
FT                   /rpt_type=INVERTED
FT                   /note="IS885 terminal IR"
FT   repeat_region   437418..437419
FT                   /rpt_type=DIRECT
FT                   /note="target site duplication"
FT   gene            complement(437832..438869)
FT                   /gene="cbbAp"
FT                   /locus_tag="PHG416"
FT   CDS_pept        complement(437832..438869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbAp"
FT                   /locus_tag="PHG416"
FT                   /product="fructose-1,6-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG416"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86165"
FT                   /db_xref="GOA:Q59101"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q59101"
FT                   /protein_id="AAP86165.1"
FT                   /translation="MALISLRQLLDHAGEFGYGVPAFNVNNLEQIHAIMEAAEETDSPV
FT                   ILQASAGARKYAGEAYLRHMVLAAAETHPDIPIVLHQDHGSSPAVCQASIRSGFTSVMM
FT                   DGSLREDMKTPSDYDYNVDVTRRVCEMAHAVGVSVEGELGCLGSLETGQAGEEDGVGAA
FT                   GTLSHDMMLTDPAQARDFVARTGVDALAIAIGTSHGAYKFSRKPTGDILAIDRIREIHE
FT                   QIPDTHLVMHGSSSVPQEWLEIIRQYGGDIKETYGVPVEEILRGIKTGVRKVNIDTDIR
FT                   LAMTGAIRKSLAEDRSEFDPRKALLAAKKGARSVVKLRFEAFGCAGQASKIKPIAMEQL
FT                   AQWYR"
FT   gene            complement(438911..440149)
FT                   /gene="cbbKp"
FT                   /locus_tag="PHG417"
FT   CDS_pept        complement(438911..440149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbKp"
FT                   /locus_tag="PHG417"
FT                   /product="3-phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG417"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86166"
FT                   /db_xref="GOA:P50320"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50320"
FT                   /protein_id="AAP86166.1"
FT                   /translation="MMSLSHASVPHTNPTAPHTLAALLAAGGLAGKRVFIRADLNVPQD
FT                   AAGDITDDTRIRASVPAIAACLQAGAAVMVTSHLGRPQEGAPDPRHSLAPVGRRLSELL
FT                   GRQVPLLSGWTEGGFQVPPGQVVLLENCRMNTGEKKNSDELAQKMAALCDVYVNDAFGT
FT                   AHRAEATTHGIARYAPVACAGPLLAAEIDALGKALGQPARPLVAIVAGSKVSTKLTILK
FT                   SLADKVDNLVVGGGIANTFMLAAGLKIGKSLAEPDLLADARAIIDIMAARGASVPIPVD
FT                   VVCAKEFSATAAAAVKDVRDVADDDMILDIGPKTAAMLADQLKAAGTIVWNGPVGVFEF
FT                   DQFGNGTRVLAQAIAESKAFSIAGGGDTLAAIAKYGIADRVGYISTGGGAFLEFLEGKK
FT                   LPALDVLEQRAAS"
FT   gene            complement(440159..441169)
FT                   /gene="cbbGp"
FT                   /locus_tag="PHG418"
FT   CDS_pept        complement(440159..441169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbGp"
FT                   /locus_tag="PHG418"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG418"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86167"
FT                   /db_xref="GOA:P50322"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50322"
FT                   /protein_id="AAP86167.1"
FT                   /translation="MTIKVAINGYGRIGRNVLRAHYEGGKRHDLEIVAINDLGNAATNA
FT                   HLTQYDTVHGRFPGEVSVDGDAFRVNGDRIRVLAQRNPAELPWGELGVDVVMECTGLFT
FT                   SKEKASAHLKGGAKKVIISAPGGKDVDATIVYGVNHGVLKATDTVISNASCTTNCLAPL
FT                   VKPLHEKLGVVNGLMTTVHSYTNDQVLTDVYHEDLRRARSATMSMIPTKTGAAAAVGLV
FT                   MPELDGRLDGFAVRVPTINVSLVDLSFVAARPTTVEEVNGILKAAAEGELKGILDYNTA
FT                   PLVSVDFNHNPASSTFDATLTKVNGTLVKVSAWYDNEWGFSNRMLDTAVALAHAR"
FT   gene            complement(441229..441924)
FT                   /gene="cbbZp"
FT                   /locus_tag="PHG419"
FT   CDS_pept        complement(441229..441924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbZp"
FT                   /locus_tag="PHG419"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG419"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86168"
FT                   /db_xref="GOA:P40853"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40853"
FT                   /protein_id="AAP86168.1"
FT                   /translation="MATVSLPCTAVLIDLDGTLVDCAPDIVEAANRMLADLGSPALPFG
FT                   TVAGFIGRGVPNLVRRVLETAQLAPRVDATDAVAMFHRHYADTNGRLGSVFPGVEAGLA
FT                   ALRRQGYRLACVTNKPRALAVPLLALTGLSQYLEVLVAGDSIAQMKPDPEPLRHACNLL
FT                   DVDAAQGVLVGDSAVDVAAARAAGIPVCLVRYGYAGPGGPAALGADALVDSLEALPALL
FT                   TPARLAPAA"
FT   gene            complement(441924..443936)
FT                   /gene="cbbTp"
FT                   /locus_tag="PHG420"
FT   CDS_pept        complement(441924..443936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbTp"
FT                   /locus_tag="PHG420"
FT                   /product="transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG420"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86169"
FT                   /db_xref="GOA:P21726"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21726"
FT                   /protein_id="AAP86169.1"
FT                   /translation="MNAPERIDPAARCANALRFLAADAVELARSGHPGAPMGMAEMAEV
FT                   VWRRHLRHNPANPAWPDRDRFVLSNGHASMLQYALLHLTGYDLPMSQLRQFRQLHAVTP
FT                   GHPEVDVTPGVETTTGPLGQGLANAVGMALAEKLLAATFNRPGFDIVDHHTYVFLGDGC
FT                   LMEGLSHEACSLAGTLGLGKLICLYDDNGISIDGEVAGWFADDTPKRFAAYGWHVIADV
FT                   DGHDAHALDAALHEAKAERDRPTLICCRTVIGKGAPAKAGGHDVHGAPLGAPEIAAMRT
FT                   ALGWEAEPFTVPADVADAWDARAQGAAREAEWEARFVSYCAAHPELAEEFVRRANGRLP
FT                   EGFDAELMALLDAPSPLQGKIATRKASQLCLEALTPALPELLGGSADLTGSNLTNVKAS
FT                   VWVNHAGHGNYVSYGVREFGMAAVMNGIALHGGLIPYGGTFMTFSDYSRNAIRMAALMR
FT                   LRVVHVLTHDSIGLGEDGPTHQPVEHAASLRLIPNNQVWRPCDGAETAYAWLAALQREN
FT                   GPTCLVLSRQALMPFERDAAQRADIARGGYVLRDVPAPRVVLIATGSEVEIAARAALDL
FT                   ADAGIAARVVSMPCVELFYAQDAAYRDSVLPPGLPRISVEAGATWYWRGVVGEQGLALG
FT                   IDSFGESAPAEALYQHFGLTPAHVAAAARVLLEDA"
FT   gene            complement(443946..444824)
FT                   /gene="cbbPp"
FT                   /locus_tag="PHG421"
FT   CDS_pept        complement(443946..444824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbPp"
FT                   /locus_tag="PHG421"
FT                   /product="phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG421"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86170"
FT                   /db_xref="GOA:P19924"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19924"
FT                   /protein_id="AAP86170.1"
FT                   /translation="MSERYPIIAITGSSGAGTTSVTRTFENIFCREGVKSVVIEGDSFH
FT                   RYDRAEMKVKMAEAERTGNMNFSHFGAENNLFGDLESLFRSYAESGTGMRRRYLHSTEE
FT                   AAPFGQQPGTFTAWEPLPADTDLLFYEGLHGGVVTDEVNVAQYPNLLIGVVPVINLEWI
FT                   QKLWRDKKQRGYSTEAVTDTILRRMPDYVNYICPQFSRTHVNFQRVPCVDTSNPFISRE
FT                   IPAPDESMVVIRFANPKGIDFQYLLSMIHDSFMSRANTIVVPGGKMELAMQLIFTPFVL
FT                   RMMERRKRAAL"
FT   gene            complement(444836..445930)
FT                   /gene="cbbFp"
FT                   /locus_tag="PHG422"
FT   CDS_pept        complement(444836..445930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbFp"
FT                   /locus_tag="PHG422"
FT                   /product="fructose-1,6-bisphosphate"
FT                   /note="seduheptolose-1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG422"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86171"
FT                   /db_xref="GOA:P19912"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19912"
FT                   /protein_id="AAP86171.1"
FT                   /translation="MPEVQRMTLTQFLIEERRRYPDASGGFNGLILNVAMACKEIARAV
FT                   AFGALGGLHGKASTQAGEEGAVNVQGEIQQKLDVLSNTTFLRVNEWGGYLAGMASEEME
FT                   APYQIPENYPRGKYLLVFDPLDGSSNIDVNVSVGSIFSVLRAPEGADTVTEQDFLQPGS
FT                   AQVAAGYALYGPTTMLVLTVGNGVNGFTLDPNLGEFFLTHPHLRVPPDTQEFAINASNS
FT                   RFWEAPVQRYIGECMAGKSGPRGKDFNMRWIASMVAEAHRILMRGGVFMYPRDTKDPAK
FT                   PGRLRLLYEANPIAFLMEQAGGRASTGRQTLMSVAPGALHQRIGVIFGSRNEVERIEGY
FT                   HTNQTDPDLPSPLFNERSLFRASA"
FT   gene            complement(445981..446706)
FT                   /gene="cbbEp"
FT                   /locus_tag="PHG423"
FT   CDS_pept        complement(445981..446706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbEp"
FT                   /locus_tag="PHG423"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PHG423"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86172"
FT                   /db_xref="GOA:Q04539"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04539"
FT                   /protein_id="AAP86172.1"
FT                   /translation="MHATEPNTGHGSQRAIRLAPSILSADFARLGEEVCAIEAGGADLV
FT                   HFDVMDNHYVSNLTIGPLVCEAIRPLVSIPIDVHLMVEPVDALIPMFAKAGANLISFHP
FT                   EASRHVDRTIGLIRDHGCKAGLVLNPATPLSWLDHTLDKLDLVLLMSVNPGFGGQAFIP
FT                   GVLDKVRQARARIDRQVAAGGRPVWLEIDGGVKADNITEIARAGADTFVAGSAVFGAPD
FT                   ADGGYRGILHRLREAATIT"
FT   gene            complement(446708..447472)
FT                   /gene="cbbYp"
FT                   /locus_tag="PHG424"
FT   CDS_pept        complement(446708..447472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbYp"
FT                   /locus_tag="PHG424"
FT                   /product="CbbY"
FT                   /db_xref="EnsemblGenomes-Gn:PHG424"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86173"
FT                   /db_xref="GOA:Q04541"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04541"
FT                   /protein_id="AAP86173.1"
FT                   /translation="MQALIFDVDGTLADTETAHLQAFNAAFAEVGLDWHWDAPLYTRLL
FT                   KVAGGKERLMHYWRMVDPEEARGCKVKETIDAVHAIKTRHYAERVGAGGLPLRPGIARL
FT                   IAEAGEAGLPLAIATTTTPANLDALLQAHLGADWRGRFAAICDAGTTAIKKPAPDVYLA
FT                   VLERLGLEAGDCLAIEDSGNGLRAARAAGIPTVVTPTTFSAQDSFEGALLVLPHLGDPA
FT                   EPMPQHVPGAAHRWADLAALRAWHHGTLIEAT"
FT   gene            complement(447476..448429)
FT                   /gene="cbbXp"
FT                   /locus_tag="PHG425"
FT   CDS_pept        complement(447476..448429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbXp"
FT                   /locus_tag="PHG425"
FT                   /product="CbbX"
FT                   /db_xref="EnsemblGenomes-Gn:PHG425"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86174"
FT                   /db_xref="GOA:Q04540"
FT                   /db_xref="InterPro:IPR000470"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04540"
FT                   /protein_id="AAP86174.1"
FT                   /translation="MSAPETTAPLQPPAAQAASLPGSLAESLASSGITELLAQLDRELI
FT                   GLKPVKARIRDIAALLLVDKLRAARGFSAGAPSLHMCFTGNPGTGKTTVAMRMAQILHQ
FT                   LGYVRRGHLVAVTRDDLVGQYIGHTAPKTKEILKKALGGVLFIDEAYYLYRPENERDYG
FT                   QEAIEILLQVMENNRDDLVVILAGYKDRMDRFFESNPGMSSRVAHHVDFPDYQLDELRQ
FT                   IADLMLAEMQYRFDDESRAVFADYLARRMAQPHFANARSVRNALDRARLRHASRLLDDA
FT                   GTVADDRTLTTITASDLLASRVFSKAAPAAQTPAKE"
FT   gene            complement(448586..449005)
FT                   /gene="cbbSp"
FT                   /locus_tag="PHG426"
FT   CDS_pept        complement(448586..449005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbSp"
FT                   /locus_tag="PHG426"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PHG426"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86175"
FT                   /db_xref="GOA:Q59102"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="InterPro:IPR036385"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q59102"
FT                   /protein_id="AAP86175.1"
FT                   /translation="MRITQGTFSFLPDLTDAQITSQLEYCLNQGWAVGIEYTDDPHPRN
FT                   TYWEMFGLPMFDLRDAAGILLEINNARSTFPNHYIRVTAFDSTHTVESVVMSFIVNRPA
FT                   DEPGFRLVRQEEPGRTIRYSIESYAVQARPEGSRY"
FT   gene            complement(449063..450523)
FT                   /gene="cbbLp"
FT                   /locus_tag="PHG427"
FT   CDS_pept        complement(449063..450523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbLp"
FT                   /locus_tag="PHG427"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PHG427"
FT                   /db_xref="EnsemblGenomes-Tr:AAP86176"
FT                   /db_xref="GOA:P42721"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR020888"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42721"
FT                   /protein_id="AAP86176.1"
FT                   /translation="MNAPESVQAKPRKRYDAGVMKYKEMGYWDGDYEPKDTDLLALFRI
FT                   TPQDGVDPVEAAAAVAGESSTATWTVVWTDRLTACDMYRAKAYRVDPVPNNPEQFFCYV
FT                   AYDLSLFEEGSIANLTASIIGNVFSFKPIKAARLEDMRFPVAYVKTFAGPSTGIIVERE
FT                   RLDKFGRPLLGATTKPKLGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFL
FT                   FVMDAVNKASAATGEVKGSYLNVTAGTMEEMYRRAEFAKSLGSVVIMIDLIVGWTCIQS
FT                   MSNWCRQNDMILHLHRAGHGTYTRQKNHGVSFRVIAKWLRLAGVDHMHTGTAVGKLEGD
FT                   PLTVQGYYNVCRDAYTHTDLTRGLFFDQDWASLRKVMPVASGGIHAGQMHQLIHLFGDD
FT                   VVLQFGGGTIGHPQGIQAGATANRVALEAMVLARNEGRDILNEGPEILRDAARWCGPLR
FT                   AALDTWGDISFNYTPTDTSDFAPTASVA"
FT   gene            450780..451360
FT                   /pseudo
FT                   /gene="cbbR'"
FT                   /locus_tag="PHG428"
FT                   /note="regulatory protein, nonfunctional due to frameshift"
XX
SQ   Sequence 452156 BP; 85392 A; 140381 C; 141349 G; 85034 T; 0 other;
     gatcttgttt caactatgtc gccaagccag cattcgtgcg cgagggcggt atcgctcccc        60
     ggttggcgca tcgcgacgaa tgccaatacc aatacagaaa ttaggagaca ggttatggtc       120
     gaaacatttt atgaagtcat gcgcaggcag ggcatttcgc gacgaagttt cctgaagtac       180
     tgttccctga cagccacatc cttaggactg ggaccttcct ttctgccgca gatcgcgcac       240
     gcgatggaaa ccaagccgcg tacaccagta ctttggctgc acggtctcga atgtacctgt       300
     tgctcggaat cgttcattcg ctcggcccat ccgctggcaa aggacgtcgt gctatcgatg       360
     atctcactgg actatgacga cacactgatg gcggctgccg gccaccaggc cgaggccatc       420
     ctcgaggaga tcatgacgaa gtacaagggc aactatattc tggcggtgga ggggaatccg       480
     ccactcaatc aggatggcat gagctgcatc atcggtgggc ggccattcat tgagcagctc       540
     aaatacgtgg ccaaggatgc caaggccatt atctcctggg gttcctgcgc atcctgggga       600
     tgcgtgcagg cagccaaacc taatcccact caggccacac cggttcacaa ggtgatcacc       660
     gacaagccga ttatcaaggt cccggggtgc cctccgattg ccgaagtgat gacgggtgtc       720
     attacctaca tgctcacctt cgatcgtatt cccgaactgg atcgacaggg tcggccgaag       780
     atgttctata gccagcgcat ccacgacaaa tgctaccggc gtccacactt cgatgccggc       840
     cagttcgtcg aggaatggga cgacgaatca gcccgcaaag gcttctgctt atacaagatg       900
     ggctgtaaag gcccgaccac gtacaacgcc tgctccacca cgcgctggaa cgaggggacg       960
     agtttcccca ttcagtcggg ccacggttgc attggttgct ccgaggatgg cttttgggac      1020
     aaaggctcat tctacgatcg tctgaccggc atcagccagt tcggcgttga ggccaacgcc      1080
     gacaagattg gcggaacggc ctccgtcgtg gtgggggcgg ccgtgacggc gcatgccgca      1140
     gcgtctgcga tcaagcgtgc gtcgaagaag aacgaaacca gcggcagtga acactaagcc      1200
     gccggggaaa cgactgaatc aggaagatcg aaataatgtc agcttacgca acccaaggct      1260
     tcaatcttga cgaccgcggc cgtcgcattg tcgtcgatcc cgtcacccgc atcgagggtc      1320
     atatgcgctg cgaggtgaat gtcgatgcca acaatgtcat tcgcaacgct gtttccactg      1380
     gtaccatgtg gcgcggactg gaagtgattc tcaagggccg cgatccgcgc gacgcctggg      1440
     cgttcgtaga acgcatctgc ggtgtttgta ccggttgtca cgcgcttgcg tcggtgcgtg      1500
     ccgtggaaaa cgcgctcgac atcagaattc caaagaacgc ccatctgatc cgagagatca      1560
     tggccaagac gttgcaggtg catgaccatg cggtgcattt ctatcacctg catgcgctgg      1620
     attgggtgga tgtcatgtca gccctgaaag ccgacccgaa gaggacttcc gagttgcagc      1680
     agttagtttc gcctgcgcat ccgctgtcct cggcaggcta tttccgcgat attcaaaatc      1740
     gactcaagcg ctttgtcgag agtggtcagc ttggcccttt catgaatggg tactggggat      1800
     ccaaggctta tgtgctgccg ccggaggcca atctgatggc ggtcacgcat tatttggaag      1860
     cgctggacct acagaaggag tgggtgaaaa tccacaccat cttcggcggc aagaatccgc      1920
     acccgaacta cttggtcggt ggcgtgccgt gcgcgatcaa tctcgatggt atcggggctg      1980
     ccagcgcgcc ggtaaatatg gagcgcttga gcttcgttaa ggcgcgcatc gacgagatca      2040
     tcgaattcaa taagaatgta tacgtgccag acgtgctcgc catcggcaca ctgtataaac      2100
     aggccgggtg gctgtacggc ggcgggctgg cagccaccaa cgtgcttgac tacggcgagt      2160
     acccgaacgt tgcctacaac aagagcactg accaactgcc cggcggcgcg atcctcaacg      2220
     gcaactggga cgaagtattt ccagtggatc cgcgcgactc ccaacaggtg caggaattcg      2280
     tgtcgcacag ctggtacaag tatgccgacg agagcgtagg tctgcatccc tgggacggcg      2340
     tgactgagcc caattacgtg ctcggtgcaa acactaaggg tacacgcacg cgcatcgagc      2400
     aaatcgacga gagcgcgaag tactcgtgga ttaaatcgcc gcgctggcgc ggccacgcga      2460
     tggaggtagg gccgctgtcg cgctacatcc ttgcctatgc ccatgcgcgg agcggcaaca      2520
     agtacgctga gcgtcccaag gagcagcttg agtactccgc gcagatgatc aacagtgcga      2580
     taccaaaggc attgggattg ccagaaacac aatacacgct caagcagttg ttgcccagca      2640
     cgatcggtcg tacgctggcg cgcgcactcg agagccaata ttgcggagaa atgatgcata      2700
     gcgactggca tgatctggtc gccaacatcc gggcgggcga tacggcaacc gccaacgttg      2760
     acaagtggga tcctgccacc tggccgctgc aagccaaggg cgttgggacc gtcgctgcgc      2820
     cgcgcggcgc tctcggacac tggattcgta tcaaggacgg ccggatcgag aactatcagt      2880
     gcgtagtgcc taccacgtgg aatggcagtc cgcgtgatta caaggggcag atcggcgcat      2940
     ttgaggcttc gctgatgaac accccgatgg tcaacccgga gcagccggtg gaaatcttgc      3000
     gcacgctgca ttcgttcgat ccctgtctgg cgtgttcgac tcacgtcatg agcgcggaag      3060
     gccaggaact cactacagtc aaggtgcgat aaaaggtgcc ggaccggcgt ctggccagcg      3120
     agcggatatc ggttcggcaa cggcacaagg agatagcatg agcacaaaaa tgcaggcgga      3180
     tcgcattgca gatgcgaccg ggaccgacga aggagcggta gccagcggga agtcaatcaa      3240
     ggccacttat gtttatgagg cgccagtgag gctgtggcac tgggtcaatg cgctggcgat      3300
     cgtagtgctg gcagtgaccg gattttttat cggctcgccg cccgcgacca ggccggggga      3360
     ggccagcgca aactttctga tgggctatat tcgctttgcc cactttgtcg cagcttacat      3420
     attcgcgatc ggcatgctgg gccgcatcta ctgggcgacg gcagggaatc atcattcccg      3480
     cgaactcttc tccgtgccgg tgttcactcg ggcgtactgg caggaggtga tttcgatgct      3540
     gcgttggtac gccttcctat ctgcgcgtcc aagccggtat gtcggtcaca atccgctggc      3600
     ccgtttcgcg atgttcttca tcttcttcct gagttcggtg ttcatgatcc tcacgggctt      3660
     cgcgatgtac ggcgaaggcg cacagatggg ctcgtggcag gagcgcatgt tcggctgggt      3720
     cattcctttg ctcggtcaat ctcaggatgt gcatacctgg catcatttgg gtatgtggtt      3780
     cattgtggtg tttgtgatcg tccatgtcta tgcagcgatt cgcgaggaca tcatgggccg      3840
     ccagagcgta gtgagcacga tggtctcggg ctatcggacc tttaaggact gatgcgcaat      3900
     gcaaccgaag cgatcgcagg ctttcgtcga taccatgcac ccgctaccgg aggtattgcc      3960
     ctcggtatgg tggcatcccg gcgtgtcacg gcgcgtgtcg gttcattcgg gctgttttct      4020
     gagtagtcat tacctcaagc cgctcggcct gtcgcagccc cacgcccgct gtctgctcag      4080
     gattgcgaaa cggcgcttgc atgaaatcat caattggaac agccgtcagg cttggaaagg      4140
     cgcctgttcc tcctttcgtg tctcggtcgc tcgccgcacg gtacacggtt ccctttttcg      4200
     ctgaccaccg ccatgagacc aactcaaacg tccgatatcg cacctggaac cagctgtaac      4260
     caatcccgtg acaaggagcc ggtggtagtt gcaatgggca ttggcaatgt gctctgggcg      4320
     gatgagggct ttggcgtgcg ctgcattgaa accctccagc agcgctatca gttcgcaccg      4380
     caggtatgcc tggtcgacgg gggcacgcag gggctctatc tgatccacca cgtgcaggct      4440
     gcgtcgcgcc tgctgatctt cgatgcgatc gactatggcc tgcctccagg aacgctgaga      4500
     attatcgaag acgaggcggt gccgaaattc cttggggcca agaagatgag cctgcaccag      4560
     accggcttcc aggaagtact gttgctcgcc cagttgacgg gacagtaccc gcagcaggtg      4620
     gtgctgatcg gctgtcagcc ggaggagttg gaggattatg gcggcagtct aaggcgggtg      4680
     atgaaggctg cggtggagga tgcggtggag aaaggggcgg acttgctgcg gagatggggc      4740
     gggatgccgg tgcctcgcac tgcggagctt gcgcctgccg aggccgtgac cgtgccgcat      4800
     ctggcgctcg atcgctacga agccgaacgt ccttcgcctc gggccgcctg ccggattggc      4860
     gatgaacgtt ttatgccaca ggatttgtga ggggcgaata tgtgtattgg cattcccatg      4920
     caggtcatgg cgatcgagcc tggatatgcg gtctgtgcgg gacgcggcga acgacggaga      4980
     gtctcgagcg cgctggttgg tgactgccag cagggcgact ggctgctggt cttcctggat      5040
     tcggcgcgtg agcggatcga tgcgctcagg gcgcatgaaa tcgatgccac gctggatatg      5100
     ctgcaagcgg ccctgctggg tcttgacgca tccgaagcgc aaccacgttt tgaactgcca      5160
     tcggcgatgg cccgcgagga cctcgccgtt ctatccaact ccagagattc ttcctcttac      5220
     taaggtaact ttcatgtcga ccgaatcagc gatgtttctt gcccccatcc cgacgacgga      5280
     cgcagtaccg ccggtgatcg aacgtctggt cgaacagcat caggctgcct gggttgacca      5340
     ggattccatt gacgactggc tggctggcgg cggcgattgc gtgctgttta tcgccggcga      5400
     cccggtgcgc tttcccgagt gcgtggatgt cgctgtcgtg ttgccggagt tgcaaagggt      5460
     gttcttcaat ggttttcgca ttggcgtggc gaaacgtgaa cgtgagcacg aagatgtgct      5520
     ggcgaatcgc tttggcacgc agcgtcgacc gtcgctggtg ttcttgcgag acggtgccta      5580
     tgtgagcgta atcgccggca tgcgcgactg ggacgaatac gtgcgcgagg tccggcgggc      5640
     gctcgcgatg ccgacttcac ggccgccatc catcggcatt ccagtgattt cggcggcagc      5700
     cggcggcagt tgccactgat ccgtcgaaca atgcctcaca ggacaacgcg atgaattcat      5760
     ttcccattcc ggtcgtgctg ctcggtcccg gttcgcaagc cgaggatgaa acgctcgatt      5820
     acatacacat gccgcagggc atgagtgtct atacaccgcc tgtgctgccg gaacccgagc      5880
     agattgcctg cctgacccaa gcgcaaagtg tgctgcgggc gattctcgac gcgctggacc      5940
     gcgcggaccc gaaacagccc aatccaagaa tcgaattgtg ggcattggac gaagaaaacc      6000
     gtcaactgct caagcaagtg cttggtgagg gggaggtgag tgcaaggatt gagggcgagt      6060
     accaggtgta tatccaggaa gctgtatttg caggggtgtg gcgcgtggtg tccacttgcc      6120
     ccgatgcgac gacggactac atcgaggttg gcgcagcacc ggaagtgctg cgcggcgcgg      6180
     cgcgttatgg cgccaatcag tggagtctgg atgtcgggcg ggtgcccgac ggtgtcatga      6240
     acgcgccctc gatcctggcg gagatcgatg accaattgct gagttggcat cccggcaagc      6300
     cggtgcatgt cgtcaacctg acattactgc cgatgtcgcc gcaagatatt acgtttctcg      6360
     acgaaactct cggtgctgca agcgtcacca tcctttcgcg cggctatggc aactgtcgca      6420
     ttagcagcac ggcagtgcca tattgctggc gggtggtgta tttcaattcg caggacacca      6480
     ccattctcaa caccgtcgag attaccgatc tgccggaagt ggcctgcgcg gccccggaag      6540
     acctgcggga ttctcacgaa cgtctgacag aggtactgaa atgggtgggg agcatatgaa      6600
     cgacgcaggt atggggcgct tcgaaggcag ttacctggga gatcgggggc gcctggcggc      6660
     cgacgcgcgg ctggaatgca agatctgctg gtgggagtac gatcctgaag tcggcgatcc      6720
     agtttggcag attgcgcccg gcacttcatt ttcggcgctc ccggcgcact ggcggtgtcc      6780
     gaattgcgac ggtgaagccg agcaatttat ggtgctcggt ccgcaggcgt gagagactgc      6840
     aacgatgttg ctggccaact atggagcctg tgaagtggac cgggtgcgcc atctggaaga      6900
     ggctttctgc tgcattgcgg caactcgcat ggccgatatc cccgtggtga accgcgcgtt      6960
     gtcggtggaa gcattggggt tcgagcagtg tgccgaatca gcgggcggct cggatggcga      7020
     aatggggatt ctcattactc cctggttcat gaacctgatt tggctagcgc catacggccc      7080
     atgcctcgga gagcgggatg cgtcgacgct gccggtggga aagacctgta tgcgacgatt      7140
     tggaagccac gacttcgaat tcatcggtgc ctcggagcca cagtttggtc cctaccaatt      7200
     ttgctcatta ttttcgccga tgtttgaatt cgccaaccag gctagtgcgc gcgcaaccgc      7260
     gacggaagta ttgcgtctgt tacgggcgtc gccagatgcg cctttaccgc caacgtgcgc      7320
     cccgcaccga gacaggcggg ggtttctgtt cggtaggcgt cgaattgagg gggaatcgtt      7380
     atgactcggg ccgtcgcgtt gaccggtcgg ctgacatttc gcccagggca ggtgccaggc      7440
     attgcgggtg agcgccccca actcgccgaa cgattgctgc gaggccggcc cggcgaggct      7500
     gcaccgcacc tcctgccgag gctctttgct ctgtgcggcg aggcgcacgg cgtcaccgcg      7560
     gcgctcgccg tgaacgctgc gcttggtcgt gtcgccgcgc ccgaaccggc gctgtttcga      7620
     aggctcgccc atgagacggc atgtgagcat atccgccgca tctggctgga ctggccgctg      7680
     catctggcca gcgggccggt gccgtccacg tttaatagtc gagtgccgca gcgcgaactg      7740
     attgattgcc cgatgttgaa ggcgtcgcat tcggagtcgg ccgccatgct cgcttggctg      7800
     gagagggcgg tgctgggaac cgcaccccgc cgctggctgg cgcattggca tgaagacccg      7860
     gccggctgcc tttccacatg ggcgaccaag atccacacct ggcctgcaat ggcaatgcgt      7920
     cagtgcatgc aggtagcgca ggccatggcg agcatgcctg cccccctgct gccgcacgcg      7980
     tcaacggacg ccttgcgcga actggcgcag tccttggccg gggaggcgga ctttccttgc      8040
     cgcccaagct ggcaaggccg ggtgttcgag actggcagtt ggacacgact ggggctggcg      8100
     gattgcagcg ccttcggcaa catgtggttg cggctgggcg cgcgcatcgc ggagttggtg      8160
     ttgctgtcgc tgcgggacgg tatgcaggca tccggggagg cacatgattc accttgtctg      8220
     caaatgggcg cattggcgct ggctcccggc caggcgttgg catggagcga aatggcccgt      8280
     ggcttgctga tgcactgggt acgtctggtg gatacgccgc aaggaccggt gatcggcggc      8340
     tatcggatca ttgcgccgac tgaatggaac ttccatccgg acggggcggt ggcgcacatg      8400
     ctcgcccacc tcgcgccgtt cgacgcggcc gatgtgcggc gcagcatcgg cattctggtc      8460
     gcggcgtatg atccttgcgt cccctatacg gtggagttcg cggagtcttt gggagatact      8520
     gtccatgcat gagctcagcc tggcgggtgg catcttgcag ttgctcgaag acgctgcgcg      8580
     gcgcgaacga tttgctcggg tcacgctctt gcgcctcgag gcaggcaagt tgtgtggcgt      8640
     ggaggtacgc gcgctgcgtt tcgcgctcga ggccattgct tcgggaacct gcctggaggg      8700
     cgcttgtatc gagatcgagg aacctgaggg acaggcctgg tgcctgcagt gcaatgcagc      8760
     ggttgctttg gcggagcgtg gcgcaccatg cagcggatgc ggcggctacc ggctccagcc      8820
     cactgcgggg accgagttgc gtgttatgga catgctggtc gaagatcact ggtgtcctga      8880
     atgaaaaatt cattgaatca ggacaccagg gtgaagcgat ctgcgagaag aaaggagtag      8940
     gcgaaaatgt gcgtcatatg tggatgcaat accaatcacg agactgcccg gcaagacgag      9000
     aataagggcg aacatgctcc cggccgtggc ctcgtcgata ccggcaccga gccgccgggc      9060
     gcggcgcatg tacggatcga tgcgtccacc ggtgatctgc actacggcgc ggggccggcg      9120
     cacgtgtctg tgccgggtct cagtcaagcg cgtgcgatca aactggaaca ggacgtgctg      9180
     ggtcacaaca atcgccttgc tgcacacaac cgtcagcatt tcgtcgcaca tggtgtgctt      9240
     gcactgaatc tcgtttccag tccggggtcg ggcaagacga ccttgctctg cactaccatc      9300
     gaagccttgc ggcggtgccg tgcggacctg cagctggccg tgatcgaggg cgaccagcag      9360
     accagtcatg acgcagagcg catccgggcc acgggtgtac ctgcgatcca gatcaatacc      9420
     ggcaagggct gtcatctcga tgcgctaatg gttgccaatg cgtacgagcg cctccccttg      9480
     cacgccgcgg cacatgcgca cacccatgag caccgtcaag aggacggaca gcattcccac      9540
     catcatgacc acgagcatgc tcgccacgat caccacgatc accgatccag cggcatcggc      9600
     agcgtcttgt tcatagaaaa cgtcggcaat ctggtgtgcc ctgcaatgtg ggatctgggc      9660
     gaatccgcga aggtggcgat cctgtcggtg accgagggcg aggacaagcc gctcaagtat      9720
     cccgacatgt tcgccgccgc cagcctgatg atcctgaaca agatcgacct gctgccacat      9780
     ctgcgcttcg atgtagcacg ctgcatcgaa tatgcgcggc aagtcaatcc gcaccttcag      9840
     gtgctgcagc tgtcggccgc gacaggagag ggcgtggacg agtggctaga ctggatgctg      9900
     gccggcggcg cggcggcagg ggctgctgcc gcaacggatg gcgcgcgcat gcgtatcgcc      9960
     gcgccggagg ccggaatcgc tgccctcgga acgcagttgg ctcccggtcc ggcggtgtcg     10020
     aaggagatgt gagatgcgag cgcagacctt gccagccggc agcgaccatg cgccggtgct     10080
     ggcttgcggt gcatggctga agaatgccgc atgcctgttg cggggcgccg aggtcctctg     10140
     gtccccgata catggcgatc ttggagatcc ggccaactgc gatgcgcttg accagtcggt     10200
     cgaacagtta cttgacagcg ctcacggcca ggtgcaggcg gtggcgcatg atctgcaccc     10260
     ggatttctat agcacgcaac tcgcgcaacg cctggcggct cggctttgcg tgccggcagt     10320
     ggccgtccag caccatcacg cgcacatcgc cgcgctgatg gcggaatacg atctgagaga     10380
     acccgtgatc ggcttggcgc tggacggcgt cggtcttggc acggatggta cggcttgggg     10440
     tggggagttg ctatgggttt ctccgtcaga gtggtgtcgc ttggggcatc tccagtcgct     10500
     gccgctgcct ggcggcgacg tggcagcgcg cgaaccctgg cgcatggcag ccgcagcgct     10560
     acatgtgctg gaccgtacgg gcgagatcgg gcggcgctac ggcgccgttg taggtgagca     10620
     ggcggcccgt accgtggcag cgatgctgga acggcaactc aactgtccac gatccagtag     10680
     cgccgggcgc tggttcgacg ccgcggcggg tgcgctgggt gtcagtgtgc ggcagcaggc     10740
     cgaggcgcag gctgcgatcg ccctggaggc gcttgcggcc gactatctgt ccgcgctgtc     10800
     gccgcctgaa tgcgtcggta cgtacgtcgt ggatcaggac ggagttctgg atctgcgtgg     10860
     gctgctggag cagctgtttg cgctggccga tgagggtcag gcggggcaag cggcgcgggg     10920
     cgcggcgctg ttccatgtgg cgctcgccga ggctctggtg gggtgggccg ctgacgcagc     10980
     gcagggccac ggactgaaga ccgtggccct gggcggtgga tgtttcatga atggcatttt     11040
     gagcgccagc gtgcaagccg gattggcagc gcgaggtttg caagcgttgc tgccgcgcgc     11100
     ggtatcgtgc ggcgatgcag ggctcgcgct ggggcaagcc tgggtcgcgg cccgccagcc     11160
     tacggctgcc ctggcgccgc aaacgcatct acaggaggag ggcgcgccat gtgcctagcg     11220
     attcccgcac gtttggtgga actgcaagcg gaccagcagg gcgtagtcga cctgagcggt     11280
     gtacgtaaga ccatatctct cgcgctgatg gccgatgccg tagtcggtga ctacgtcatc     11340
     gtgcatgtcg gctacgcgat tggcaagatc gatccagagg aagcagaacg cacgctgcgt     11400
     ctgttcgcgg aattggagcg agtgcagccg cctgcgtccg agccgatgca tgggatgaac     11460
     attcatcagg agccggcatg aaatacatcg aagaatttcg cgacggcgag ctggcgcaac     11520
     gcattgcggc gcacgttcgc gctgaggcgc ggccggggca acgctacaac ttcatggagt     11580
     tctgcggcgg acacacgcat gccatttcgc gttacggcgt gaccgaactg ctgcccgaga     11640
     acgtgcggat gattcacggg ccgggctgcc cagtgtgcgt gctgccgatc ggccgcattg     11700
     acctagcgct gcatctggcg ctggagcgcg acgccatcgt ctgcacttac ggcgacacga     11760
     tgcgggtgcc ggcctcgggg ggcatgtcgt tgattcgggc caaggcgcac ggggccgaca     11820
     tccgcatggt ctactcggcc gctgatgcgc tgaaaattgc gcagcggcat ccacagcgcg     11880
     aggtggtgtt ccttgccatt ggcttcgaga ctacaacgcc tccaactgcg ctgattattc     11940
     gcgaggcgaa ggcgcgccag gtggataact tcagtgtgtt gtgttgccac gtgcttacgc     12000
     cgtcggccat tacccacatc ctggagtcgc ccgaggtgcg cgactatggc actgtgccca     12060
     tcgacggatt cgttgggccg gctcatgtga gtatcgtgat cggtacccgg ccctatgagc     12120
     atttttcacg cgagtacggt aagccggtgg tgatcgcagg cttcgagccg ctcgatgtga     12180
     tgcaagccat tctgatgttg gtacgacaag tcaacagcgg acgcgcagag gtggaaaatg     12240
     agttcgtgcg cgctgtcacc cgcgatggca acgagagcgc gcaggccatg gtgtcggaag     12300
     tgttcgagct gcggccgtct ttcgagtggc gaggactcgg cgaggtgcca tatagcgcct     12360
     tgcgcatccg cgcgcagttt gcgcgtttcg acgctgagca acgcttcgat ctgcgctacc     12420
     ggccggtgcc tgacaataag gcttgcgaat gcggcgcgat cttgcgtggc gtcaagaagc     12480
     caaccgactg caagctgttc gctaccgtct gcaccccgga gaatccgatg gggtcgtgca     12540
     tggtatccag cgaaggtgcc tgcgccgcgc actattcgta tgggcggttc aaggatatcc     12600
     ccttggtggc agcatgagcg gcaccgttaa actgggctat caacggcccc tgaacatcaa     12660
     gagcggcaga atcgacatgg gccacggcgc gggggggcgc gcagccgcac aacttatcca     12720
     ggaactgttc gttgctgcgt ttgacaatga gtggctgcgc cagggcaacg accaggcggc     12780
     tttcgccatg cctgccgggg ccagaatggt gatggccacc gacgcgcacg tggtgtcgcc     12840
     gctattcttc cccgggggtg acatcggtag cctgtcggtg cacggcacca ttaacgatgt     12900
     ggcgatggcc ggtgccaaac cgctgtatct ggccgcgagt ttcatcctcg aggaagggtt     12960
     tccgctagcg gatcttaagc gcattgtcga atcgatggcc ggggctgcgc gtgaggctgg     13020
     cgtgcctatc gtgacgggtg acacgaaagt ggtcgagcaa ggcaagggtg atggcgtatt     13080
     cattaccact accggcgtcg gcgtggtgcc agcgggcatt ctaatcgacg gcgccggggc     13140
     caggcccggc gacgctattc tgctctctgg cactatgggg gagcatggcg tagcgatcct     13200
     gtccaaacgc gagtcgcttg aatttgacac tgagatccgc tcggacagcg ccgcgctgca     13260
     cgacttggtg gcacagatgc tggccgtggt gccgggggta cgagtgctgc gggatcctac     13320
     gcgcggcgga ctggcgacca cgctcaacga aatttccagt caatcgggag tgggcatggt     13380
     gttggacgaa gcggcgatcc ccgtcctgcc acaggtggac gcggcatgcg agctgctcgg     13440
     gcttgatccg ctgtacgtgg cgaacgaagg taaattggtt gccatttgcg cagctgcgga     13500
     cgcggatgcc ctgcttgccg ccatgcgggg gcatccgctc ggtcgcgagg cacggcgcat     13560
     cggagaggtc atcgaggacg ggcgccactt tgtgcagatg cgcacaaaat tcggcgggat     13620
     gcgcgtggtg gactggctgt ccggcgagca gcttccgcgc atttgttgag cgagtcggct     13680
     atgcgcatat tgctcctcac ccatagcttc aacagtctga cgcagcgact gtttgtcgag     13740
     ttgcgccagc gcggccacct ggtgtcggtg gagttcgata ttgccgattc cgtgaccgag     13800
     gaggccgtgg cgctgttcgc ccccgatctg gtcatcgccc cttttctcaa gcgtgcgatt     13860
     ccggaacgaa tatggagtcg actggtctgt ctggtggtgc atcctggcat tgtcggcgat     13920
     cgcggcccga gtgcgctgga ctgggcgatc gttcgagacg aacgaagttg gggtgtgacg     13980
     gtgttgcagg ccaacggcga gatggatgca ggtccggtat gggctagcgc cacgttccca     14040
     atgcgcgcgg cacgcaagag cagcctgtat cgtaacgagg tgacggtggc agcagtacaa     14100
     gctgtgctgg aggcgctggc ggcttttgaa gccggctggc gttcggcgaa tgatgcgcag     14160
     agcggcccgg gcacctggaa tcctgcaatg cggcaggctg agcgcggcat cgactgggcg     14220
     cgtgagtcga ctgccgccgt gctggcaaag ctacatgcgg ccgatagctt tcccggcgta     14280
     ccggatgcct tgttcggcca gccgtgccgg ctgttcgacg cccacgccgc gaccccgcag     14340
     acggtcgcac gcgcgccgcg aggccagcct ggcgatatcg ttgcgcgccg tgagcatgcc     14400
     gtgctgcgcc tgacggtgga cgcaggcgtg tggatcggtc acgccaagct ggccgtgcgc     14460
     gatgagtggg aaaacacaag cctgccatct ctcaagctgc cggtggcgca agtatttcat     14520
     gaggcgtggg cgcaattgcc ggacctgtcg ctgccgctgg aacacgacgc cggcgagtgg     14580
     agcgagttcc ggtactggga agacgattcc ggcgcgggcc tggtcggata cctcgccttc     14640
     gactgctata acggggcgat gtcgaccgcg caatgccaac ggctttgcgc cgccttgcgc     14700
     tacgcgcgcg gtcgccagac gcgggtgctg gtgctgctgg ggggagagga ttttttcagc     14760
     aatggtattc atctgcacca aatcgaggcg gcggagcacc ggggcgcgga gagcgcggcc     14820
     gatgcctcct ggcgcaatat tcaggcgatg gacgacgtcg cgctggaaat ccttgcgttt     14880
     tccgatcgca tgacggtgtc ggcgctgcgc ggcaatgcgg gagcgggcgg cgtgttcttg     14940
     gcgctggcgg ccgatcaggt atgggcgcgc gaaggtgtac tcgtgaatcc gcactacaag     15000
     aacatgggca atctgtatgg ttcggaatac tggacctatc tgttgccgca acgcgtcggt     15060
     gcgcaacgag ccagtgatct gatggacggc cgtttgccaa tgtcggtccg gcgggcgatc     15120
     gagattgggc tgatcgatgc cagcttggac ggcgacgcgc gctcgtgcct tgccgagatt     15180
     ggccgccgcg ccgttgcgct ggcccgggcg ccagactatg ctgcgcatat tgacaacaag     15240
     cggcgaaaac gggccgcaga cgaagcggca aagccgctgg cccagtatcg agaggaagaa     15300
     ttggtgcata tgcatcggaa tttctatgga ttcgatccga gctatcacgt ggcacgctat     15360
     catttcgtct acaaattacc ccatgcacat acgcctcgcc accttgccat gcaccggggt     15420
     ggcagcctgc cggcggcaca agagttgcag gcacttgcgg ggaaacgatc ttgagccatg     15480
     tctgacaagc aggccactgt tcttgtcgtc gacgacgaaa cccgttcaca ggatgctctc     15540
     cggcgcactc ttgacgagga attccgtgta ctgacggtca gctccgccga cgaggcacgc     15600
     gccttgttgc tgcgccagcc ggtctcggtg atcctgtgcg atcaacgcat gccaggcctc     15660
     acgggggtgg aatttctcaa agaggtgcgc gagcgctggc cggaaatcgt gcgtatcgtc     15720
     atctcaggct ataccgattc ggaagacatc attgcagggg ttaacgaggc gggtatctat     15780
     cagtacatcc tcaagccctg ggtaccggac catttgatcg acaccgtgcg ccaggcagtc     15840
     gaggcacagg ggctgcaggg cgatatgcat cgccttgatc tcgagttgcg caccagcacg     15900
     ccggtcttgc gccagcgaag cagccagaaa ctggcaagtg cgcagagcgc attcaatttc     15960
     gagcgcattg tgcgcgcacc gggcagccca ttggatgccg tttgcgaggt cgccgcccgc     16020
     gtggcgcgtt atgatttgcc ggttatggtg ctcggcgagt ccggcaccgg caaggagttg     16080
     ctggcgcgcg ccattcatta cgccagccca cgcgcggcgc gcgcctttgt cagcgagaac     16140
     tgcgctgccg tgccggacaa cctgctcgaa tccgagttgt tcgggcacaa gcgcggcgcc     16200
     ttcaccgggg cgtacgaaga tcatgccggt ctgttccagc gcgcgaacgg cggtaccatt     16260
     tttctggatg agattggcga tacttcgccg gcgtttcagg tcaagcttct gcgcgtgctg     16320
     caggaggggg aggtgcggcc agttggctcg ccacgttgga taccggtcga tgtccgtgtc     16380
     atcgcggcca cccactgtaa cctggaaagc gacgtccatg ccggacggtt ccgcgaggat     16440
     ctttattacc ggatcgctgg cgtcaccatt tcgatgccgc cgttacggga gcgtagtggg     16500
     gatttgcagc ccatcgcggc caagctgctg gagcaggtgg cgcaggagct ggcccgcccc     16560
     ggtctgtatt tcggtgggga cgcacttgca gcgatgatgg cgtatccctg gccgggcaac     16620
     atccgcgaac tgcgcaatga gatttatcgg gcggtagcgc tctcctcggg cgaagagatt     16680
     cgcgcgcaac ttttctcgcg caaggtgctg cacggtcagc ccggcaccgt caagcgtggg     16740
     ccgcatgtgc agactttccc gcagtcgggt acgctgcagg agcgacttga cgcgatcgag     16800
     gcggtggtgc tgaaggaggc gctcctgcgc catcgttgga acaagaccca tgcggccaag     16860
     gagttgggtc tatcgcgcgt cggattacgt cagaagctgt tgcgctttgg cttggaggag     16920
     aaatgaacgc gcctgtatgt accggtcttg cctcagcaaa acccggcgta ttgaatgtgc     16980
     tctggataca gtccggcggc tgcggtggct gcagcatgtc cctgctttgc gcggacacta     17040
     ccgatttcac tggcatgctc aagagtgcgg gaatccacat gctttggcat ccctcgctat     17100
     cgctggaaag cggcgtggaa cagctgcaaa tattggaaga ctgcttgcaa ggccgcgtcg     17160
     cactgcatgc cttgtgtgtc gagggggcga tgctgcgcgg tccgcatggt accgggcgct     17220
     ttcatctcct cgccggcact ggtgtgccga tgatcgaatg ggtcagccgc ctggcagcgg     17280
     tcgccgacta cacgctggcg gtcggcacct gtgccgctta tggcggcatc accgcaggtg     17340
     gcgggaaccc gacggacgcc tgtggcctgc aatacgaggg ggaccagccc ggaggactgc     17400
     tcggcctcaa ctaccgctca cgcgccggcc tgccggtgat caatgtcgcc ggttgcccga     17460
     cgcatccggg ttgggtgacg gatgcactgg cattgctgtc ggctcgcctg ctaaccgcga     17520
     gcgacctgga taccctgggc cggcctcgat tctatgctga tcagttggtg catcacggtt     17580
     gcacgcgcaa cgagtactat gaattcaagg ctagtgcgga aaagccttcg gacctgggtt     17640
     gcatgatgga aaacatggga tgcaagggta cccaggctca cgccgattgc aatacccgcc     17700
     tatggaacgg agagggttcc tgtacccgcg gggggtatgc ctgcatcagt tgcactgaac     17760
     ccggcttcga agagcccggc caccccttcc accaaacacc caaggttgcc ggcatcccga     17820
     tcggtttgcc caccgatatg cccaaagcct ggtttgtcgc gcttgcttcg ttgtccaagt     17880
     cagccacgcc caagcgagtg aaacttaatg ccacggcaga tcatccgctg atcgcgccag     17940
     ccattcgcaa gacgcggctg aaataggagg cgagcatgga acgtttggtg gtggggccgt     18000
     tcaaccgcgt tgagggcgac ctcgaggtga acctcgaggt cgccagcggt cgggtatgct     18060
     cagcacgtgt gaatgccacg atgtaccgcg gattggaaca gatcctgcta caccggcatc     18120
     cgcttgacgc gctggtctat gcgccgcgtg tgtgcggtat ctgctcggtg tcccagtcgg     18180
     tcgcggccag ccgcgcattg gcggatcttg ccggcgtgac ggtacccgct aacggtatgc     18240
     tggcgatgaa cttgatgctg gcgaccgaga atctggccga ccatctgacg cacttctatc     18300
     tgttcttcat gccggatttc acgcgcgaga tatatgctgg ccgcccctgg cacaccgacg     18360
     cgacggcacg tttttcgccc acgcatggta agcaccacag gctggcgatt gccgcaaggc     18420
     agcgatggtt taccttgatg ggcaccctgg gcggcaaatg gccgcacaca gaatcggtgc     18480
     agcccggtgg ttcgtcgcgc gccatcgacg ccgctgagcg cgttcgcctg ctgggccggg     18540
     tgcgcgaatt ccggtgcttt ctcgagcaga cactgtatgc cgcaccgctc gaggacgtcg     18600
     tcgcgctcga cagcgaagtc gcgttgtggc gctggcatgc gcaggcgccg caggccggag     18660
     acctgcgatg tttcctcacg atcgcgcagg atgcggcgct ggaccagatg gggcccggcc     18720
     cgggtacgta tctgtcatat ggcgcctacc cccagcccga aggcggtttt tgcttcgcac     18780
     aaggtgtgtg gcgtagcgcg caagggcggc tcgacgcgct tgatcttgcc gcgatcagcg     18840
     aagatgccac ctccgcctgg ttagtcgacc aagggggggc gcgtcatcct gccaatggcc     18900
     tgaccgcgcc agcacctgac aaggtgggcg cctatacctg gaacaaggcc cctcgattgg     18960
     ccggcgccgt gctggagacc ggtgcgatcg cccggcagtt ggccggcgca cagcccttgg     19020
     tgcgtgacgc ggtggcgcgc tgcggcgcca ccgtctatac gcgcgtattg gcgcgactgg     19080
     ttgaactggc gcgagtggtg ccgttgatgg aagactggtt acagtcccta gaaatcgggg     19140
     ccccatattg ggcgtcggcc cacctgccgg atcagggcgc tggcgttggc cttacggagg     19200
     cggcgcgcgg cagcctgggg cactgggtgt cggtgcgcga tgggcgaatc gacaattacc     19260
     agatcgtcgc acccacgtcc tggaacttct cgccgcgcga tatagccggc cagcccgggg     19320
     ccgtggagaa agcactcgag ggtgcgcctg tgctgcaagg cgaaacaacg ccggtcgccg     19380
     ttcagcacat tgtccgctcc ttcgatccct gcatggtgtg caccgtgcat tgagcatgca     19440
     cctcaatcac cacgatcata tggcacgggc aagccgaagc cgacgtggca acgttgcgtc     19500
     gcatcctcgg gcacctgatt gccattatcg ccatgtccag taagaggacc actacatcaa     19560
     gcgggagtca cggcgtcgat ctggacgcca tgacaccatc gcaactcgag ggtatcgacg     19620
     aagcgacctg gctggacgtg atccgcaaaa tggacgaggt ctacctgcaa ttgatagagg     19680
     acgaagtagc gctggaggaa aagaacgctc aactggagca gtcccagcaa ttcatcttca     19740
     gcctgctttc ggcgatgtcg gacgtactgg ttgcttgcaa tgcgcgtggc gaaatagagg     19800
     agaccaatgt ggcgctgcgc gaactggtag gcatgcagga gagcgctctg cacggcatgt     19860
     cgatttatca gttgctggcc gacgacgaca gcgccgcgac gttgcgcacg gtgatcgaca     19920
     atgtggggcc tggccggagt ttcaacgttg tcgagctaaa tctgttcgat gccgaacgca     19980
     gcatcgtgcc ggtggacgtc agttgcacgc cccgtatcgg tccgaatggc aggcgtgaag     20040
     gctatgtttt cgtgggtcgc ccaatggccg agatcaaacg tgcctatcat caattgcgcg     20100
     aggcgcacga ggcactcaag cgtacgcagc agcaactgct gcatgcggaa aagatggcat     20160
     cactcgggcg ccttgtcgct ggggtggcgc acgagttgaa caatccaatc agcttcgtgc     20220
     tggggaatgt gcacgcgctt aagcgctaca gcgaacgcct cgcagcctac gtggcattgc     20280
     tgcatagcgg agaggatggc gctgaagccg agcgccagcg gattcgcttg cgcatcgatc     20340
     atattctgca ggatatgccg tcgttgatag aagggacgct cgagggcgcg cagcgcactg     20400
     ccgacatcgt gcgtggcctg acgcgctttt ccgctgtgga tcgtgaagag ccaagcgtgt     20460
     tcgatttgag cgaagtggtg aaaagggcca ttcactgggt gaagaaagga actgcgccga     20520
     ctttcgaagt ccattggtca ccgctaccgg gatgcctggt gatgggcagc gccgggcacg     20580
     tgcagcaggt aatgatgaat ctgattcaga atgcctacga tgcggcgggg agccgtgacg     20640
     atgccgttcc ggcattgtgg atcgccttgg accgactcga cgaccgggtc gtgctgcgct     20700
     ttcgagacaa cggtcccggc attgcggctg aacacctggc ccgcgtgttc gatccattct     20760
     tcagcaccaa gcctgttggc aaggggactg ggcttagtct ttcgatcagc tatggcattg     20820
     tcgagagaca tggcgggcgc ttgctcgtcc gcaaccaccc ggagggcggc gcggagttca     20880
     cggtcgaact gccagctgct cacgacaagg ggtcgtccgc agaccggcgt tgatcggttg     20940
     ccggggcccg gctccgcccg tgttccgggg aacgcctgtt cgaaattggc ggaggcagga     21000
     ggctgatggc ctgatttccc tgctgcacca ggctagaaag cgctgctccg gctatttaga     21060
     ctcccatgga acatggtatt gccatctgga tatgggcatg tcaccaatgc gatgatcatg     21120
     caaacctgct ttgcagtcct cacgtacgga cttgcgcagc agataccgct atttcgggaa     21180
     tagcataagc gaaccaagac ctgagagtga gcttctgccg cattcgccag gagttggctc     21240
     gcaggcgcgg aaattgcgtt acggtgcagt cgagccttac tggcaaaagc cgcggatgac     21300
     agcggcgtcg gaaccgagac aggagacttc cagcatgttc caattgctcg ctggcgtacg     21360
     catgaattct actggccgcc cgcgggccaa gatcatcttg ctctacgcgc tgctgattgc     21420
     attcaatatc ggcgcctggc tctgcgcgct cgccgcgttt cgcgatcatc cggtgctgct     21480
     cggcaccgca ctgctggcct acggccttgg gttgcgccac gcggtagacg cagatcatct     21540
     cgcggcaatc gacaatgtca cccgcaagtt gatgcaggac ggcaggcggc ccatcacagc     21600
     tgggctttgg ttctcgcttg gccattcaag tgtggtagtg cttgcttcgg tgctgatcgc     21660
     tgtcatggcg accacgctcc aggagcgtct ggacgcgttt catgaagtcg gcagcgttat     21720
     cggcacgctt gcttccgcgc tatttttgtt cgccattgcg gcgatcaatc tggtgatcct     21780
     gcgctcggcg tatcgggcgt tccggcgtgt gcggcgcggc ggcatctacg ttgaggaaga     21840
     ctttgacctt ctgttcggca accgtgggtt cctggcgcgt atcttccgtc ccctgttccg     21900
     gttcatcaca cgcagttggc atatgtaccc gctcggcatg ctctttgcgc tcgggttcga     21960
     taccgcgacc gaggtcgcct tgctcggcat ctcgacgatg gaggcttcgc gtggcgttcc     22020
     gatttggtcg attctggtat ttccggcgct gttcaccgcc ggcatggcgc tgatcgacac     22080
     catcgatagc atcctgatgt gtggcgccta tgcgtgggcc tatgccaagc ccgtgcgcaa     22140
     gctctattac aacatgacaa ttaccttcgt atcggcgatt gttgccctca tcgtcggtgg     22200
     cattgagacg cttggcctcc tggccgacaa gttcatgttg aagggcgttt tctggaacgc     22260
     ggttggcgct ttgaacgaga atttctgtca attgggcttc gtcattattg gcatctttac     22320
     cgtgtgttgg gtcgtgtcga tcgtcgtcta tcgcttgcgc cgctacgacg acagcgaagt     22380
     gcgtgcctga gggcccgcca agctgtccca atagtcccca ccgggcgcgc cggctcgcaa     22440
     aacgtgaaac gtccacggcc agggaagcgc ttcctggcag ataggaaggc ttgctgcgtg     22500
     aagacgtgca ggccccttcc gactaggact accacgtcga ggcgacccgc ctcgcctgcg     22560
     ggatggcgca ctcggtcgac gtctcggtca aggcgcgcgg ggcaacttga actcactcaa     22620
     aaccggtcac gccggcgagt ttgatctcac tgatgaggag agcgagcggt cgaatgctac     22680
     cgcgggcgcg aatatactgc cgtaccggcg cagagattga aatctctatc ctggcggaaa     22740
     atgacgtctc gaagcgcgat gtcccgaatc tacaaaggcg acgcttccga actcgccact     22800
     ggtcgggtgc gctcggtgta ttgactcgct aatgcccgct tagcagcgag catattaggg     22860
     caatgctgat taagtctttc ggttcgtgag agtaagcgtt atctgaagaa tcacgagcgc     22920
     gaagagatga acatgaagca gatgacgttc gcggcgggtg cagatcaaga ggcgggattc     22980
     gagcaatacc gtaagccaac gcgacgcgag acatttctgg cgatgatgga gacgatcgtg     23040
     ccgtgggcgg cattgtgcgc cgtgatcgag ccgtactatc cgaaggcggg caacggccgg     23100
     ccgcccattg gcctggaacg gatgctgcgc atccactttt tgcagcactg gttcaacctg     23160
     gcggatctgg cctgcgaaga ggcgctgtat gacagcgcca gcctgcgccg cttcgttggg     23220
     attgacctgg gtcgtgaacc ggtgccggac gccagcacgc tgctgaagtt tcgccggtta     23280
     ctggagaagc accagcttgc cgagcggctg ttcgctgagg ttggccgggt cctccaaacc     23340
     aacggtgtaa agctgaagac tggcaccatt gtggatgcca ccatcatcgg cgcaccgagt     23400
     tcgaggaaga atgaagagaa gtcgcgcgag ccggagatgc accagactcg caaagggaag     23460
     caatggtgtg tgtcacgaac gcaggcttaa gtctgcgatg ctgtactgaa gatgggagaa     23520
     ggcctcccgg agtcggcttg caggagcaga ttccaaacca cccggtgctg ctgcgttcaa     23580
     aaggcgtggt ggtgagcgac cggggacgtc atccgcagag gatggcgggt acgtgctgag     23640
     aaagcaaacc gtccgatgac gcatcgttat tgccagggcg ctgtcgaaac tgaggccggc     23700
     cattcgcttc aggacaaacc gggacgacac ctgtttacgg gtccggtggc agccggtgta     23760
     taggcggcat gatctcagcg caggctttgg tacggaacgt gagaatcttg ctccagatgt     23820
     gaagggaaat gacaaatggc agacaccatg aggaagaata ccgatgctgg agtgaggggc     23880
     ggagccgccc gtagtagcgt tgaagttcct gtaatgggaa tggagcgaag gggcggcgtt     23940
     atcctgctga tgaacgcggt caacctgcgg ggatgagcgg cgtgaaatcg gcgaagccgt     24000
     acaacattgc gaagcgcacg gtatgggagg cataccagca ggtcaaggcc aaccgtggcg     24060
     ctgccgggat cgacgatgaa gccatcgccg agttcgagca gaacctgtcg aagaatctgt     24120
     acaagctgtg gaaccggatg ccatcggggt cgtatctccc gccaccggtc aagcaagtgg     24180
     agattcccaa ggcgtcggga ggtacgagaa agctgggggt gcccacggtc gcagaccgtg     24240
     ttgcgcaaac cgtggtcaaa ctggtcattg agccgggtct cgacgcgatc ttccatccgg     24300
     actcctacgg gtaccggccg gggcggtctg cgaagcaggc ggtagcgatc actcgtgaac     24360
     gttgctggcg atatgactgg gtggtagaat ttgacatcaa ggcagccttt gatcagatcg     24420
     atcatggact gctgatgaaa gcggtgcgca cccacatcag ggaagactgg atactgctat     24480
     gcatcgaacg gtggcgggtt gcaccgttcg agacagcgga cggggtgcgt gtgccccgca     24540
     cgcggggaac accccagggc ggtgtgagca gtccgatcct gatgaacctg ttcacgcatt     24600
     acacattcga ccgatggatg cagcgcacca gcccaaactg tccgtttgcc cgctacgcgg     24660
     atgatgcggt ggttcactgc aatagccgca ggcaggcgga atacgtgatg cggtccattg     24720
     cagcacggct ggcagcttgt gggctgacga tgcatccgga gaaatcgaag atcgtgtact     24780
     gcagagacag cgcaaccgca gcgaacgcca tctgcacgcg agctttacgt ttctcggttt     24840
     tacgtttagg ccgaggaaag cgctcagccc gcaagggggg ccttttacca gcttcctgcc     24900
     gggagccagc gagagtgcct tgaagcggat gcggcaggca gtgcggggtt ggcgactcaa     24960
     tcgccagacc catgtaacac ttgccgatgt ggcgagactg tacaacccag tgatacaggg     25020
     gtggtggaat tactatggcg cgttctacaa gactgcgatg cttcacatct tccagcacat     25080
     cgactgcgct cttgagcgtt gggcccgacg gaagtacaag ggtctgcaca ggcgcaagcg     25140
     acgaagtgcc gaatggctgg acaggatgcg ccgtaacaac ccgatgctgt tcgctcactg     25200
     gcgtgtggtt acgcaaccgg ctggataacg ggagccctat gacgcgagag tgtcacgtac     25260
     ggttctgcga gaggctcggg gggcggttcc ccgggtctac ttaccacttc ggcatgaagc     25320
     tccacattgg cgtggacagt cagattgggt tggcccattc ggcagtcgta acgccagcca     25380
     atgttcatga caagcatgca gtgcaccagc tattgcatgg gcaggagcag cgagtctatg     25440
     gcgatagcgc ctacgccagt cagcaggcgc tgatcgcgtc caaggcgccc cgcgccaagg     25500
     acttcaccaa tcagcgtacg cgcaagagcg ggcagattga cgaggtgcaa cgtgggaaga     25560
     accgcaacaa atcgaagatc cgtgctcggg tcgagcatgt gtttgccgta gtcaaacgcc     25620
     tgtggggctt cactaaagta cgctaccgtg gcttgaagaa gaatgccggc cgggccttca     25680
     cggccctggc gctggccaat ctgtacctca gccgagggca tttgatggga gcagtccgtc     25740
     cgtaaagggc gaatgtgggg caagtgctcc gccaacacgc cccatttggg atgcggcagg     25800
     aaaaattcgc gtcatcagag ccgagttttt cgaccgcaca cgttcttatc agtctgaaca     25860
     caccaattca cgcggcttgt tcagcatagc cttagtcgcc agccgtactc cgtagaagac     25920
     caacttgcct caagcaatct ttggagatga ttccgatgac tcagaaattg accttcaccc     25980
     gatttgtcat cgccgagcag catggctcga agaccgttga ttccgatctg atcgcgctgt     26040
     tgctcgacgt ctccattgct tgccggaaga tcgccagctc gatcgccaag ggctcgccgc     26100
     tggcgctggg tggcgaagcg gcaggacggg acgtacccgg ggaaatccag agcaagaccg     26160
     acatggccac cccctgtttc ttcgcgcgct cggaagcgct cgcccggcac ttggccggaa     26220
     tggcgtcgga aggcatggaa ggggcctatc cggtgccgct ccgctcgccc cagggcaggt     26280
     acctgctggt ttgcgatccg ctcgacggct cggccaacat tgacgtgaac gtctctgggg     26340
     ggatcatctt ctcagtcctg cgttgcccag aaggcatatc ggcgcctgag gagcgcgacc     26400
     tcctccaagc gggtagcgcg cagatggccg cgggatacgc actgtacgac gcgcccgcgc     26460
     tgctggtcct gaagaccggc agcgggatcc atggatttac gctcgacgcg gattctggcc     26520
     aatacgtgct aacccacccg aacgcgaaga tcccgcaggt acctgctggt tcgcgatctg     26580
     cgcttcggcc aagtacttct gggcagtctt gaaggaggct caatgattca gtgtgcattc     26640
     aagattgtga tgaaagccgt agggaagaat tgcgcatcgg gtcaaaggcc gggttgtcgt     26700
     gacgctcccc aggcgctcgc gccgcattgc ggcccgtgcc tgcgacggcc ctcgacgctg     26760
     gcgatcggag ttgcggtaag ctgctgcgcc atccctcatg gcgcctcgat cgccggcggc     26820
     gtgcagcagc ccgaggcgca actcaggacg gtgaccgtgc aaggctcgca ggcggaggca     26880
     gatgcgaccg gggaggctgc cagtcagggc tatgtcacgc gcgggcagct cgaaaaccgg     26940
     ccactgctgc ggcccaggga actgcttgaa acggtgccgg ggctgatcgt cacgcaacac     27000
     agcggcgacg gcaaggctaa ccagtacttc ctgcgcggct tcaacctcga ccatggcacc     27060
     gacctggcca ccaccgtggc aagcatgccc gtcaatatgc gcacccatgt gcatggccag     27120
     ggctacaccg acctcaactt cgtgattcct gaactggtga gtggcattgc ctacaagaag     27180
     ggaacctact tcgcggaaga gggcgatttc tccgcggccg gcgcggtccg gatagattat     27240
     gtttccagcc tgccgcaagg catcgcgcag ctggagctgg gccagcacgg ctaccggcgc     27300
     gcgctgctgg ccgactctaa tcaggtagga ccgggcacgc tgctctatgg cttcgaatgg     27360
     ttgggcgaga acggcccttg ggtgctgccg gaaggcgtgc acaagctcaa cggcgtgctg     27420
     cgctacagct tgccgctggg cggcggcgag cgcctaggca tcacggcgat ggcttacaag     27480
     aacgcctgga actcgacgga ccaggtgccg cagcgcgcca tcgaccaggg cctgatctcc     27540
     cgctttggcc atatcgatcc caccgacggt ggcgcatcgt cgcgctacag cctttccgcc     27600
     gactggcagc ggccgctcca ggacggccag ttcaaggcca atgcctatat gatcaagagc     27660
     cgcctgcaac tgttctccaa cttcacctac gcgctgaaca accccgagcg cggcgaccag     27720
     ttcgagcagt tcgagaaccg ggtgaccacc ggcgccaatg cgtcgcgcac ctggttcggc     27780
     acgctcgcgg gacgcgacac tgagtccgaa ctcggcacgc agctgcgcta cgagcggctc     27840
     gatcccatta cgctcaacaa cactgcggcg cggcattcct accagcaagt ccgcagcgac     27900
     cgcgtcaacg aaaccagcgc cgcgctgtat ctgcgtaata ccgtccaatg gctgccctgg     27960
     ctgcgcaccg tggccggcct gcgcgcggac cagttctggt acggcgtgtc cagcgacaat     28020
     cccgccaatt ccggcaacgg tcgtgatcac atcgttagcc ccaagctgag cctggtgttg     28080
     tcgcccacgg ccaagaccga tgtgttcgtc aactgggggc gcggatatca cagcaacgac     28140
     gtgcgcggcg ccaccgccac ggtcgatcct tccacgggag atcccgtgca aaaggtgagc     28200
     gtgctagttc ccgccacggg ttgcgagctg ggtgtgcgca caggggacgt gttgcccggg     28260
     ctgcagttgt cggcatcgct atggcgcctc aatatcggct ctgaactggt gttctcgggc     28320
     gataccggca ctaccgagcc gagccggcca agccggcgca cgggcatcga gctgaccgcc     28380
     tactatgtgc ccatggcagg gctcatcatc gacgcggacg ccgccttttc ccgcgcgcgt     28440
     ttccgcgatc acgagagcat cggcgactac attccggaat ccatccagac caccgcgtcg     28500
     atgggcttgt ccgccaaccg gggccgctgg tcgtttggcg cgaggatgcg ctattttggc     28560
     ccgcgtccgc tgatcgagga caacagcgtg cgctccgcct cgtccttcct ggtcaatctc     28620
     aagctcggct accgcgtgca aaagaacgtg cggatcttcg cggaagtact gaatgtgctg     28680
     ggcaagcggg ccaacgatat cgactactac tatgcttcgc tgctcaaggg agagacattt     28740
     cccctggatg ccagcggtgc ggccgccggc atcaacgacc accatatcca tccggctgag     28800
     ccgcgcacct tgcgcgttgg catcacctgg agtttttgat aacgaagcaa gcggccccgg     28860
     ctagggtggc cacactcctt cggccgctca ccaggcctaa tcccattcgg aacaagagtt     28920
     ttgacgtccg cataaatctc aactagcggt tcttagcgga cagcgcccaa tcgttcggat     28980
     tttccgatcc gtgcgtttct tctgcatcgc aacatccgtg cagccggtca gcagcttttc     29040
     attttgggct gtgtaccgat tagattgatc gtcacaacga tgcgtgaaaa gcgatcgcag     29100
     ccatgcaacg cgccagcaag ctcccttttc cactatcttt ttgatcccgg ttgtcatggc     29160
     acagaatttg ccaattaata gggaacttgt cagatgattg tgcgactgca gcatccatca     29220
     aaagaataat gaagaggtgg ctaggctcat ttgattacac acatctcagt cgtcaagttc     29280
     acgggcgtac cggaggccgg cggcaaaatc caccactcgc tgcagccctt gccagatggt     29340
     cttgactccg ggttcgccgt cgcctttgcg cgccaggaag ccgccgagca tggcgaccaa     29400
     gcgcacgacc tcgttcagac gcggtgacgt cttcggtggt ttcttcttgt tgagaatgaa     29460
     tgccgcgcgc cattcatccc gctcgaacag cagccctgca tccaggtccg ggcaagttcg     29520
     gcccagtcgc atcaaccgag cgatgcgcca tgccaccacc atgaacagcg ccaaggcacg     29580
     ctcaagccgt gccatcgatg tgaccttgcc cctgttccac gaatcccata agcgagggaa     29640
     ttaggcagcc cggtgttgct gagctgcgaa ccagtttttc tcgaacgtca tggggctgac     29700
     gtagcccagc gtcgagtgga gccgggtggc attataaaag ccaagccagt caattacctc     29760
     atccattgcg gcgcggcggg tagcgaactg gcgaccgtgc aggcgagcga ccttcaacga     29820
     cccccacaga ctctctgtcg gcgcgttgtc ccagcaatcg cccctgcggc tcattgacga     29880
     gcgcatgcca tacgccttca gggcgtcttg aaacaggtga ctgcaatact gggcggattc     29940
     aatcggtcgg tgtgcacaat caaaccggct tccgggcggc gccggaacca ggccatgcgc     30000
     agcgcgtccg tgaccaattc ggccttcatg tgtggttgca tcgaccagcc aaccacctgc     30060
     cggctgaaca ggtcgatgat gaccaccaag tagagccagc cttcggctgt cgccacatag     30120
     gtgatgtcgc tcgtccagac ttgattgggt gctgcaggac taaagtcgcg ttgcagcaga     30180
     ttgtgggcca ccggcaaatc gtggttcgag ttggtcgtcg caatgtactt gcgcttgtgg     30240
     cgggcgcgaa tgccgtgcag tgccatcagc ttgcgaacac gctccttgcc cacccgcaca     30300
     ccacgcgcca gcagttcctt ccacatgcgc ggccagccgt actccccctt gaccccgacg     30360
     tgaatcgcct tgatgtgggc cagcaaggca tcgtcactga gtcggcctct atcgggcctg     30420
     tcggtgctta ctgtgcgttg cttgcgctgg tgatagccgc tggggctgac ccccatcagc     30480
     tcacacagga ccgagaccgg ccagtaacgt cggttttgct cgatgaacgc atacttcaca     30540
     ccgactcctt cgcaaagtat gccgcggctt tttttaaaat atcgcgctcc atcttcaagc     30600
     gcgccacttc cgcccgaagc cgggccagct ccatctgctc gggactaacc ggcttcatcc     30660
     ccgccccagt cagcttgcct tcccgctccg ccttgaccca gttatgcagc gtctgcgctc     30720
     ttatacccag ggtcgcgcta accaccgcca tgctttgccc gctcttcacc agccgtaccg     30780
     cttccagctt gaattccagc gtgtactgcg cccgctttgt cttgcttgtc atcacatctc     30840
     tccttgcttc agtttaacct cagcaaggga ttcgttttac gggggcaagc tcaatgcgag     30900
     ttgcaacgcc tcgacccgac agccgttctt aagcacgtga aagaatagtt cgacctccca     30960
     acgcgcgcgg taccagtcaa taagctgcgc cgctgcgtca aggtcgtcca cctcgcgatt     31020
     actcagcagt cgccattcaa tcggcttgac gcctgccggc gggtcgacct cccgggcgac     31080
     gatgcaagtg gcgctcacca cgccgcccgc agcatcaggc aacgtgacac gttgcgccca     31140
     cacctgctgc cgtaccgcgc gcgccggctg agcctgacgg gctgccagcg taaagtgaat     31200
     cctgcccact ggcttacccg cagtcacttg gtcccacagc ttgccgccgc caggcaaggt     31260
     gcgattgtgc tgcgagcgca gtagccaatc cgccgggtgg cccaactcct ttgccttgac     31320
     catcagcgcc atgatgtccg actcccggtc agccacatag acgagtcgcg tggcaggcag     31380
     tgcggccgcc tgttcggcga cccgctcata tccttcggtc cagcgggtac tttccttgat     31440
     gccggggcgc acgccatccg cacccttggg ctcgcgcgcc cacatgtagg cgtcaagcac     31500
     gcccagcggt tcgcgcgctg gcgttaccgc gtaagtcggg tgcagatata gcccgcgttg     31560
     cgcctcatac gacagcggtc ccaagcctgc gatggcctgg ccgttaaagt ccaactctaa     31620
     cgcagagtgt atttttatgc ggagccccgt tcatggaggc cccgttggcg aatgaatttg     31680
     actacttttt tctctgcata agggaacccg gtcttagaga ggcgatgagt tcatccgtag     31740
     ccttgaagcg tccggaacgc agatttggcg ggacgattgc ttcgagcgct tccaatttta     31800
     ccgatgggtc cgcacgtgtg tagatctcgg tcgtctgcat gtgtgcgtgg ccgagccaaa     31860
     gcgaaacctt tctgagatcc ttggtggctt gcaggacgga caacgcacaa gtgtgcctcc     31920
     tatatcgttc acgatatagg aggcactatg tgcccttccc gactatgtct ggtaatcgaa     31980
     cgatagccct atttcgcggg caaacagatg gccgcagata gagatagtct tgactccttc     32040
     cttcagcccc agagcattcg ggaaggagtc catcatgaga tacaccatcc atgaccgtgt     32100
     cgttctcgca cgcgcaccag acggcccgct cgcgtcccat atcgccgcct ttgcaagctc     32160
     gatcgctgcg cagggataca gcacccagtc actgaagtat cacgttcggc tcgttgcagg     32220
     ttttagccgc tggctcggtc gaaacggaat tgacttgcgt aatgtctgtc ctgatcaagc     32280
     ggcgcgttac ttacgttaac gcgcgcggca cgtgcgaccg ggtccgggag atcgtgctgc     32340
     gctcaagcat ctcattgctt ttctcgatcg tgagaggctg attccggcgc agaggacgcc     32400
     cgcgcgtcgg ctgaccccgg ttgagtcctg taccctggct tacgttgagt atcttcgcga     32460
     ggtgcgcgcc ctgtccaagg cgacgatcat caactacacg ccgttcatca gggagtttct     32520
     cgaagattgt tttggtgacc ggcgcgtcag gctttcgcgt ttgcgtgccg gcgatgtcgt     32580
     gaactttgtg caatttcagg cacagcatct gcatctgaag cgcgcgaagc tcatgacggc     32640
     agcgctgcga tccttcctac gttacgcgtg ctatcggggc gacatgacgc tcgatctggc     32700
     cgccgctgtt cccgtggtgg ccaactggtc gatgcagtcc atccctcgcg ggattccccc     32760
     agagcagata caggaactgc tggtcagtat cgatcgacgg actgccgttg gtcgtcgtga     32820
     ttacgccatc atcctgctac tcgcgcgcct gggactgcgt tctggggaag tggcatttct     32880
     cgacctcgac gatattgact ggaacacagg agttttaagc gtgcgcggca agagtggcct     32940
     gcgtaacggg ctgcctttgc ccgccgatgt tggcaaggcg attgcagcgt accttcgcta     33000
     cgggcgaccg cagagcacga gtcgccgtgt atttttgcgt gcgaaggcgc ctttcaccgg     33060
     ctttcgtagt gcgtgtggcg tgggctccat cgttcggcat tcgctccagc gcgccggtat     33120
     caacgcccca accactgggg cacaccagtt tcgtcatgca ctggccagcc agatgctccg     33180
     tcacggcgcg tcactccgtg agattggtga gttgttggga caccatcatc cacagaccac     33240
     gtcgatctac acgaaggtcg acatcaaggc attgcgtacg ctggccgtac cgtggccggg     33300
     aggtgtgcga tgaacacgct gcggcaggcc gttcaggagt atctggacct caggcggagc     33360
     ctgggcttca agctgaggga ggccggcaag gccttgcctg atttcgtcgc gttcatggag     33420
     aggcaccgtg cttcctttat cacccaggcg ttggcgctct tgtgggccca gcaaccttcc     33480
     aacgtccaac ccgcccgctg ggcgagccga ctcagtatcg tgcgcgagtt tgcgcgtcat     33540
     cgtagtgcga ccgacccacg cacacagatt cctgcaccgg gtctgctacc gttttcgccg     33600
     aagcgggccc gaccatacct atactcgagc gacgagattc gcagactact ccatgctgcg     33660
     cttcagatgc cctgccgctt cgcgcgtgac gaactgcaac catggaccta ttactgcctg     33720
     tttggcttgc tgagtgtatc gggaatgcgc ctgggcgaag cgcgcaatct tgagcttcag     33780
     gacatcgatc tgacagcggc aatattgacg atccgcggcg ccaaacttgg caagtcccgg     33840
     ttcgttccac tgcatgcgtc gacctgcaac gtgctcgcgg actatattgc acgacgcaaa     33900
     cgtcattggg cggggcgacc cgtgtcctcc tacttgttcg tgtctaacca gggcaaccgt     33960
     ctggatagtg gcgagattca tcgacacttc tatgcattgt cccggcagat cggtctgcgt     34020
     ggcgcagccg acagtcacgg cccacgtctg catgacatga ggcacgtatt tgcgacgaat     34080
     acgcttttac gctggtaccg ttccggacag gaccccgagc gccgcctgcc catcctgtca     34140
     gcttacctcg gtcatgtcca catcgaggat acgcagtggt atctgaacgc ctcgccggag     34200
     ctgatgcgcg aggcgatgcg ccggctcgaa cagcgctggg agattcaacc atgactacta     34260
     ccgccagtct cgctccgttg ctggagcgtt tctttacgca acgcctgatg cagcagcgcc     34320
     aggcgagtcc ccacacgatt agttcctatc gcgacacctt tcgtcaattc ctgaagttcg     34380
     cgctgcaacg cctgcaccgg cagccttcac gcatgaattt cgaggaaatc gatgcccctt     34440
     tgatcgttgc atttctcgat gacctggaga agcgtcaggg cgtgagcgtt cggagtcgaa     34500
     atcttcgcct tacggcaatt cattcattct ttcgttacgc ggcgctcgag acgccggctc     34560
     attccgcgca gatccagcga gtgctcgcta tccccagcaa gcgctttacc cgcaccctgg     34620
     tgcaattcct gacgcgccag gaagtcgatg cgctgctcgc cgcaccggac cagcgtacct     34680
     ggtccggccg acgcgatcac gcctttttgc tcttcgccgt acaaactggc ctgcgcctgt     34740
     ccgagatgac tggacttaag cgcgatgacc tcgtcctcgg aatcggtgct cacgtgcggg     34800
     tgatcggcaa gggtcggaaa gagcgttgta cgcccatcgt cagatccacg ctcgccgtgc     34860
     tgaaagcctg gcttcgggaa cccaagcgcg gtgaggggga cgtgcttttt ccgaacgcga     34920
     ggggcgaacg tctcaccgtt catggcgtgc agtatctcct aaacaagcat cgagagaccg     34980
     cgtcaaaagt ttgtccgtcg ttgaagcaca aacaggtcac cgttcaccgt ttgaggcata     35040
     cgatggccat ggaccttctg caggcgggcg ttgatcgttc cgtgattgcg ctgtggctcg     35100
     ggcatgaatc ggtggaaacc acgcagattt atctcgaagc gacacttgcg atgaaggagc     35160
     aggctctcgc gaagacatct ctggctcaag gcaagccagg acgctaccgg cctgcagacc     35220
     aacttctcgg cttcctgaat ggactgtaag gccacggaac tatgtcgggt aatgactggc     35280
     gggatggctc cgcgagaagt gcgcatcgga cgatcacgga cgctcatcct cattacccga     35340
     tatagtcagg aagggcatat agtgccgcag tgaatgtggt gtcggcctcg gcatcccagg     35400
     gccacacggt aggcctatct tcttcgcggc agcgcgaaat gcgatttcga catcattgat     35460
     aattaatggc tttcttgccg tcgaaatgaa cacgtgatcg tcgaatggag cgtagggccg     35520
     ccgccgttcc aaataccgct ccagcccggc cccagcgctg tcgtgcaagg gaacgaggcg     35580
     gctcttgttg ctacgccgct agcggcgtag tcgcaactat gccgcgttca cggcaatgcc     35640
     gatcaagctg ggatcggatc acgatgatgc ttatagagag cccagcagga ggtcattccc     35700
     aaagtcgccg gatcggcata gttttaatgg ctaaagaccc ttgagaaacg tcgcgagctt     35760
     actgtcaggc cggtatcgta cgggcttgcc atcatgtggt ccgacattag cgagaatctt     35820
     ttccttcagc tccagactgg catccaggta aatctgggtt gtctggagcg attcgtggcc     35880
     catccacagg gcaatgttga atggatccac gccagcttgc aataattcca tggctgccgt     35940
     gtggcggcta tatcgtccac gatataggag gcactatatg cccttcctga ctatatcggg     36000
     taatgaggga tttgcctccg tgctcgtccg atgcgcactt gttgtggagc catcccccgt     36060
     cactacccga catagtttcg tggccctaca gtccattcag gaagccgaga agttcgtctg     36120
     ccggccggta gcgtcctggc ttgccgtgag ccagagatgt cttcgcaaga gcctgctcct     36180
     tcatcgcaag tgtcgcttcg agatagatct gcgtggtttc caccgattca tgcccgagcc     36240
     acagtgcaat cacggaacga tcaacgcccg cctgcagaag gtccatggcc atcgtatgcc     36300
     tcaaacggtg aacggtgacc tgtttctgct tcaacgatgg acaaattttt gacgcggtct     36360
     ctcgatgctt gtttagcaga tactgcacgc catgaacagt gaggcgttcg cccctcgcgc     36420
     ttggaaacag cacgtcgtcc tcaccgcgct ggggttcccg cagccaagct ttcagtacgg     36480
     cgagcgtgga tctgacgatg ggcgtacaac gctctttcct acccttgcca atcacccgca     36540
     cgtgagcacc ggttccgaga acaaggtcat cgcgtttgag tccggtcatc tcggacaggc     36600
     gaaggccagt ttgcacggcg accagcaaaa aggcgtgatc gcgtcggccg gcccaggtac     36660
     gctggtccgg tgcggcaagc agggcatcga cttcctggcg agtcaggaat tgcaccaggg     36720
     tgcgggtaaa gcgcttgctg gggatagcaa gcacccgctg gatctgagcg gaatgagccg     36780
     gcgtctcgag cgccgcgtaa cgaaagaagg aatgaattgc cgtgaggcga agatttcgac     36840
     tgcgaacgct cacgccctga cgctgctcca ggtcatcgag aaatgcaacg atcaaagggg     36900
     catcgatttc ctcgaaattc atgcgtgaag gctgccggtg caggcgttgc tgcgcgaact     36960
     tcaggaactg acgaaaggtg tcgcgatagg aactgatcgt gtggggactc gcctggcgct     37020
     gctgcatcag gcgttgcgta aaaaaacgct ccagcaacgg agcgagactg gcggtagtag     37080
     tcatggttga atctcccagc gctgttccag ccggcgcatc gcctcgcgca tcagctccgg     37140
     cgaggcgttc agataccact gcgtatccgc gatgtggacg tgaccgaggt aagctgacag     37200
     gatgggcagg cggcgctcgg ggtcctgtcc ggaacggtac cagcgtaaaa gcgtattcgt     37260
     cgcaaatacg tgcctcatgt catgcagacg cgggccgtga ctgtcggctg cgccacgcag     37320
     accgatctgc cgggacaatg catagaagtg tcgatgaatc tctccactat ccagacgatt     37380
     gccctggtta gacacgaaca agtaggagga cacgggtcgc cccgcccaat gacgtttgcg     37440
     tcgtgcaata tagtccgcga gcactttgca ggtcgacgca tgcattggaa cgaaccggga     37500
     cttgccaagt ttggcgccgc gaatcgtcaa tattgccgcc gtcagatcga tgtcctgaag     37560
     ctcaagattg cgcgcttcgc ccagacgcat gcccgaaacg ctcagcaagc caaacaggca     37620
     gtaataggtc catggttgca gttcgtcgcg cgcgtagcgg cagggtatct gaagcgcagc     37680
     atggagtagt ctgcgaatct catcgctcga gtataggtat ggtcgggccc gcttcggcga     37740
     aaacggcagc agacccggtg caggaatctg tgtgcgtggg tcggtcgcac tacgatgacg     37800
     tgcaaactcg cgcacgatac tgagtcgtcg cgcccagtgc gcgggttgga cgttggaagg     37860
     ttgctgggcc cacataagag ccaatgcctg ggtgatgaag gaagcgcggt gcctctccat     37920
     aaacgcgacg aaatcaggca atgccttgcc ggcatcttta agcttgaagc ccaagctccg     37980
     cctgaggtcc agatactcct gaacggcctg ccgcagcgtg ttcatcgcac acctcccggc     38040
     cacggtacgg ccagggtacg caatgccttg atgtcgacct tcgtgtagat cttcgtggtc     38100
     tgcggatgat gatgtcccaa caactcacca atctcactga gtgacgcgcc gtgactgagc     38160
     atctggcagg ccagtccatg gcgaaactgg tgcgcccccg tggttggggc gtcgatgccg     38220
     gcgcgctgga gcgagtgccg aacgatggag cccacgccac tcgcaccacg aaagccgata     38280
     acaggcgcct ttgcacgcaa aaacacacgg cgactggtgc tctgcggtcg cccgtctcga     38340
     aggtatgctg caatcgcctt tccaacatcg gcgggcaaag gcagcccgtt acgctggcca     38400
     ctcttgccgc gcacgcttaa aactcctgtg ttccagtcaa tatcgtcgag ctcgagaaat     38460
     gccacttccc cagaacgcag tcccaggcgc gcgagcagca ggatgatggc gtaatcacga     38520
     cgaccaacgg cagtccgtcg attgatactg accagcagtt gctgtatctg ctctggtgga     38580
     atcccgcgag ggattgactg catcgaccag ttggccacga cgggaacagc ggcggccaga     38640
     tcgagcgtca tgtcgccccg atagcacgcg taacgtagga aggatcgcag cgctgtagtc     38700
     atgagcttcg cgcgcttcag atgcagacgc agtgcctgac attgcacaaa gttcacgaca     38760
     tcgccggcac gcaaacgcga aagcctgatg cgcccgtcac caaagcaatc ttcgagaaac     38820
     tcccttatga acggcacgta attgacgatc gttgctttgg acagggcgcg cgcctcatgc     38880
     agatactcaa cgtaagcctg tgtacaggac tcaatagggg tcagccgacg ctcaggcatt     38940
     ctctgcgccg aaatcagcct ctcacgatcg agaaaatcaa tgagatgcct gagcgcagca     39000
     cggtctcccg gacccggtcg cacgtgccgc gcacgataac gtaagtattg cgcactgtga     39060
     tcaggacaga cgttatgcaa gtcaattccg tttcggccaa gccagcggct aaaacctgca     39120
     acgagcctaa cgtggtactt cagtgactgc gtactgtatc cctgcacagc gatcgagttc     39180
     gcaaaggcga cgatatggga cgcgagcggg ccttctggtg cgtgtgcgag aacgacacgg     39240
     tcatggatgg tgtatctcat gatggactcc ttcccggatg ctctggggct gaaggaagga     39300
     gtcaagacta tctctatctc cgtgcatccg tttgcccatg aaatagagag gcctcttttg     39360
     aatttcaagt gggtggtatc gtggcgggtt tcaggtaaag agcaacaaga gcgatgcata     39420
     gcaaactgtt tgaagcagcc cttggcataa gcgatccgtg gttcgtccgg gaagtcgact     39480
     tcaacgcgca aaccaagacg ttgacgatcc agattgactt tgtcgccggc agccgctttt     39540
     cccacccgga ggtcgccggt gggcacccgg ttcacgacac ggtgaccaaa cgctatcggc     39600
     acctgaactt cttcgagcac gactgctatc tggaagtccg cacgccacgc gtgaagcttc     39660
     ccgacggccg cgtggtgttg gtcgagccgg actgggctgg caagctctct ggcttcacgt     39720
     tgctgtttga agccatggtg gtggcgcttg cgcagcagat gccgttttct gctgtagcca     39780
     gaacggtggg tgagtcgtgg catcgcgtgt acgctatctg cgagcgctat gtcgacctcg     39840
     cggtggccga actcgatctg gccggcgtga ccgctgccgc cgttgacgaa acgtcctaca     39900
     ggcgcggtca caactacctg acgcttgtcg ctgatgccga cgcgcgtaag gtcgtgtttg     39960
     tgaccgaagg caaggatgct gccacggttg gcaagttcgc tgcacatctg cgcgagaaca     40020
     acgctgcgcc tgagcagatc ggggtggtca gtatcgacat gtcgccggcg ttcatcaagg     40080
     gcgtcagcga gcatttgccc aacgcgcgca tcaccttcga caagttccat gtcgtggctc     40140
     acgcttctgc agccgtggac aagacccggc gtatcgaaca gaagaccgat ccaagcctca     40200
     aaggcctgcg ctggacgctg ctcaaggatc gcgacgggtt gccagccgcg cagcgtgccg     40260
     atctcgacgc gttgatcgcc aacgtcacga ccaaacgcac tgcccgtgcc tggctgtatc     40320
     gcgagcagtt gcgcgaaatc cttgagcgca agcagatcaa cgttgtttcc gcaatgctcg     40380
     agcagtggtg cacgaacgtc atgcgatcca aggtcgagcc aatgaaggag gtcgcgcgca     40440
     tgatccgcaa gcatttcgac ggtatcgttg catggaccca gacgcgccag accaatggct     40500
     tcctggaggc gctcaacggc ctgttccaag ccgccaagcg caaggcccgc ggttatgtga     40560
     gcttcaaaac catgcgcacc gtgatcttcc tgatcgccgg aaagctcgac ttctccgcga     40620
     tcaacccgca tgccgcataa cccactcatt tttcaaaaga gccatagaga gctatctttc     40680
     gattacaaga catagtcggg aagggcatat agtgcctcag cacgtgcggc gtcactcgtt     40740
     tctttcgcag cgaaggacat cccatggcag cctgggtagc gtactttttc aggagacgtt     40800
     gtaccgcgtc cggactgaga tgtccacctc gaacactcgg aaatagcgcg tcgctgttgg     40860
     gtgtgcgagg ctctttcatc caagctttta gaatagcggc ggtctccttg ctaaaagggg     40920
     taacgcgctg ttttcgacct ttacccataa catcaatgtg cgcgcctgcg ccgagggtca     40980
     cgtcctcgcg tgtgaggccg gtcatttccg acacacgaag tcccgtctcc acacccagtc     41040
     ggagtaacgc atgatcgcga cgaccacacc aggtgcgctt atcgggtgca gcgagcagcg     41100
     ccttgacttc cggccgtgtc agaaagtgaa tgagcctgcg atcgtagcgt ttgttgggca     41160
     tcgacagcac gcgctggatc tgcgcggaat acgcgggcgt ctcgaaggcc gcgtaacgga     41220
     agaacgagcg aatcgctgtc agtcgcagat ttcgggtgcg gacactgata gcccgggtct     41280
     tctccagatc attcagaaat gctgtcacga gcggcgcatt gatgtcctca aatgccagat     41340
     gatccggcgg tttgtgcaga cgcttgtagg caaaacgaag cagcagcctg aacgtgtccc     41400
     gataggaact gatggtgtgc ggactggcct gccgttgttg catgagacgt tccgtaaaga     41460
     accgctgcac taatgatggg aaaccgacgg tagatttcat gacatatcct tccagcgacg     41520
     ctccaggcgc ttcatcgcct gcttcatgag ctctgggtgc tgctcgacat accagtatgt     41580
     atctctcgcc cactggtgcc cgaggaacgt cgacagcacc ggtaaccaac gcaccgggtc     41640
     tttacccgac cggtctaatc tcgccagcgt cgtgaccgca aataaatggc gatagtcgat     41700
     caggcgggga gcgcgctttg ctgacgaatc gcgaagaccg atttcccgtg tgagcgccgt     41760
     aaatgtatga gaaaccatgt ctccactgag tggcttgcct tgcgaagtga tgaacacatg     41820
     ggtttccggg cgccccgcaa gacatcgcgc gcgacgtcga agatagtctg caagtgcatc     41880
     tcgagtggag gaatgaatag gaacccacct cgactttcca aatttgcttc cccgcaccgt     41940
     cagtacgcat tctttcaagt caacgtcttc gagttccaga ttgaccgctt cgccggggcg     42000
     caaccccgtg acgcttagca gtcctatcag cgtaaaatat gtccaccgcc gcagtcccga     42060
     ttccggagga agagccagcg cggcagccaa tatcttctgg gtttcctcat cggtgtaaag     42120
     gtagggagca cgccgatgat accggtgcgg caacaattcg gcccgtggaa tctctgtatg     42180
     cggatcgaag gcactcagat agcgtgcaaa gccacgcacc acacctaatc gctgagccca     42240
     gatcaccggt tgaaccgacg gggacttttg tgcccaggtc aacgccagtg acgcgctgat     42300
     gtgagaggcc cgatgtcgtt ccataaagca gacgaagtct tccagacgtt ggcctgcttc     42360
     atggagtttg aatcccagac gacgacgcat cgtcaggtat tcttccattg atttgcgtaa     42420
     cgtactcatg atcgggggct cggccatggc ggcgccaagg tccgcagtga atccagatcg     42480
     accttcgcgt atattctcgt cgagtcggga cttttgtggc gcaagacttc gctaatctcg     42540
     gccagcgagg atccttgacg cagcatctgt gtcgctaacg catgccggaa ttgatgggtt     42600
     cctttcctca acgaatcgat accagcccgc tctagagcgt atctgacaac attgcatacc     42660
     gctttttccg tcttgaaccc acgaatcggc gcgtttatac gcaggaagac acttcgactc     42720
     tcagaatccg cgcgaccgtt tttcaggtag tcggcgatcg cttcacccac cggcgcgagt     42780
     aatggcaacg gcgactcctg accgcctttt ccgtgaatgt tcaacgtgcc cgtttcccaa     42840
     tcgatgtcat ccaacgtcaa ggaaaccacc tcgccgctcc gcaaccccag ccgggcaagg     42900
     aggagcagaa tcgcataatc tcggcggccg acggggcgac ggcggtcgca actggccaac     42960
     gctcgcctag catactcagg ggatatcgct ttggggattg atgccattga ccagtgggcg     43020
     accctgggga tcgctgcagc gaggtcaagc ttgatcaagc cacgataacg cgcatactgc     43080
     aaaaacgagc gcaagacctt tgcgatcgat tgcgctcgcc ctggactttg agtggcctca     43140
     tgctgaacaa agtcgatgat ctcgcgggca ctgagatccg agagccgcgt cgccccatca     43200
     ccgaattgct ttgttaaaaa caaatgcgca caccaccgat atttcctgat cgtcgtggct     43260
     gccaagcctc gttcctggtg cagatacaaa gagtatccgt ttaccaattt ttcaactggt     43320
     gtctgcgcac cggacgcttc ctttgctacg attccatttt cttgaagcaa ttgtacaaag     43380
     cgtcttaccg catatctcgc gccgttccga tgacagcggt ggtgttctcg gtagcgcaga     43440
     taacgttgcg cagtttcatg agtcacttcc tcgatcgaca ttttcttgca cttgagccac     43500
     acgctgaaat cggcaacgag aagcaagtgt ctgcgaatag actcctgcgc gtaaccttga     43560
     tcattcagca gaccttcaaa tgcaccgagg tgttcagcaa gggggccctc gggtgtatcg     43620
     agtgagtgcg accgcgtttt ttggtacaac ttctccatga ccttcgcctc ttgtaaaagc     43680
     gggtctaaca tcaatcagac tatgccgatc atccttcgtt cattgccttg aatttgcggc     43740
     tcgccacgtc caaatcgaac atagttaact acgcggcata gttgcgaaac ttagaggatc     43800
     gaatcaccag tccctctggg gtgatgtctt cgtagcgtag gccgatggct tccgataccc     43860
     ttagcccggt gcaagcaagt aatgcgaaca gtgtgctgta ggtatatcgc cgcaacgttt     43920
     cacgccccga ctgggaggct gcctgaacga ggtggcggac ctcgtccgtg gaaaagatat     43980
     aagggatagg tcgaatccgt tggctgctgc cgaagacggg cggaggcact tcatggcgag     44040
     aatcttcggc ccgtgcgtac cgagcaaatc gaatcacctc accgagtcgg cgagctcgtc     44100
     gaggtgccaa gcgtgccaat ccagcccatt cgatggcggt atcggcgcac acgtgggatt     44160
     taccccttgc gtctgagtag gcggcgaagc tgcgcaacag attgccctgc gacttaagtt     44220
     caaatccaca ggcacggcgc acttccagat atgactgcac ggtttgcttt aacatggcag     44280
     ttcctccggc catggttggg caatctgccg caacgcggcg atgtccactt ttgcataaat     44340
     ttgcgtagtc gcgacagatt gatgccgtag aacggccgca atatcctgca gggacgcacc     44400
     ttgccccaac atcgacgttg caaccgaatg gcgcagcaca tgggcggcgc ctcggctcga     44460
     gcagacaaca ccagctcggc gcattgcctt cttaacgatg atggagatgg cagcatgatt     44520
     tgcaaaggct tgaaacgggg cacacgcgcg gacgaatacc gtatcggtat cggttcgagg     44580
     ccgtccctgt cgaagataat ccacaatggc ctgcccgact tcctgtgtca gaggcaggag     44640
     tgtctgccgc ccgtttttgc ctgagaccga gatcgaggca tctttccaat cgatatcccc     44700
     gatgcgcaga tgccaaatat cgccggcgcg aagccccaaa cgcgccagca gcagcaaaat     44760
     tgcacggtcc ctctgaccga ctggcgacgc tgtgtcacat gaagcgatga cgcgttcgac     44820
     ttcgtcgagt tgcaaatatc gcggcagcgt tgacaggctc caatgtgcca agacgggtat     44880
     cgctgcctcc agaccggcag cgcacttgcc ttcggctatc agaaaccgaa cgagcatgcg     44940
     taatgccgtc gtgcagtgct ttgccgccgc ccatcccttc ttcatgcttt gctcaaggat     45000
     gaactggcgc aagtccattg cattcagttt gccgaggtca tcccctcgtc tgaatagatc     45060
     tcgaagcgca ataccgtggt tgtacaaagt ggcatcactg gttccacgct gttggcgcat     45120
     ccattggcag aatgcgaaga actgaactga ttccaggtcc gctgcaagcg cagtaaaacc     45180
     gattgcccgg gtgctgattc ccccttggta cgtcaggaac atccgcgcac cccgtaacga     45240
     tacgatgcgc cgctgatgcc caaagccctg gcattggcat cgactcaaat gttcagcgaa     45300
     acgttcaaga gtcaattcgt taaaactggg aagcggtatg ccttcccgat tcgcccaaca     45360
     caggaagtgc gatgccgcag caatacgggt gcaaatagaa ctcttcgcgt aaccgagctg     45420
     ctccaggtat tgagagaagc cttcaagcag cgggccgcct gggcgagaga gaagcagttg     45480
     aacgtgcgaa ggggatttga agtactgact aagcatgacg tcctccttga gcagaagtct     45540
     ccagtcgagt ggccagaaag acgtcaatat tatgcggagc aatgccgagc aaacgcgata     45600
     ctcgatctgc tttgagagaa gtccagttac atccgcttcg gtgaactact ccgcattaaa     45660
     atacactctg cgttagagct gtaacgcggt gcacggcgtt acagctccgt ggtgtcttgg     45720
     atgcatagca ccacttcgca agctcgcatt cgctcggctg agctctgcca gtggggagcc     45780
     agaatatcgc gccagtccag ttcatcctga gccaggaagc ggtatgccgc agccgtttcc     45840
     gcccagccgc cgcatgcgct ggggatgctt gccgtcggct tctctgcgag ccgctccgct     45900
     agcagcaccg cccgcttgtt caggcgctgg tcgcccaagt caatgtcctt gaattctgcc     45960
     gctgcccaac tcgttgcctc tcgcttcatg tgccgcccaa aatgcaagag tgaacgacaa     46020
     tccgaaagag tttacaaccc cacccgctat gtcattgacc gtaaacgact tttcgcggca     46080
     caccatgggt cacgacttgt gtgtaatggg gtgcctcgaa ggatcgtctg cctgcgcaag     46140
     ggcagagaaa gttaaattct atcaactcaa tctggaggat gcggatctaa tcagtcgaaa     46200
     acaacgggtg ctgttcgtcg atgcctcaaa ggacgcgaca ttagacagct ttcgcttgta     46260
     tagggcggag ccgaagatgg atttcagttt tacctcgcat gggcgttgtt gcacaaatcg     46320
     aatttgaagg cggagttacc cctgagtggc gaaattcaag caatacggac ggactgcggg     46380
     cgggcaagct cattcatgtg gttgagcacg cccgcgcgga ttgccacctc ggtcgcctgg     46440
     gagcctacct tgcgcgccca cagagaatga ccggtgagtg tcttgagtcg atacatcagg     46500
     ttctcgacca gcgagcgacg gtggtacccg ctgtcctttt tccattcgcg tctgctgctc     46560
     gttgcaatgg cgtcgatggc cgcattgcgc catgccgcac cgggcgtggt ttcaggccac     46620
     ggcatcgcgc cctcgcgcgg cggaatcgac ggttgcgcgc ctgtggcggc aatcactgca     46680
     tggcacgact tggtgtcgta cgcgccatca ccgcgaacga tgtccacgag cgtgtcgggc     46740
     ggcaactggt cgagcaaatc aggcaacacg tcggcatcgc cgacgtcctg atgggtcatc     46800
     aacgccgcgc atatctggcc gctcttggcg tccatcgcca gatggacttt gcgccacgtg     46860
     cgacgcttgg aatacccgtg cttgcgcacc ttccactcgc cctcgccaat acgcgcaaga     46920
     gagaaaaaat ggacatcagc cagagccctg caaatactag aatcagcaga ctaccgggtg     46980
     tccatagagt cagcagaaaa aaatggacac aacgaccgtc agaatgtcca tttccagtcg     47040
     caagtttcgc agctgatttc gagtgaagat gcacgccgca atctagcgta gctgcaaggg     47100
     caggacgcta ccgccacgca gcgcggccag ttccttgcgc aggcggaaca cctgatggag     47160
     cagggcaagt tcacgagcca gcgattcgtc aagctgtgcc tgcagatcct tcgcgtcgcc     47220
     ctttgcgcgg ttcagacgct cggtgagttc gagcttcggg cgcccggcca ctgcattggc     47280
     cgcgtcgatc gctgcgatca gttcggtgaa ctgtgggcgc gacttcttga tgctgccctt     47340
     cttgcggccc gcctcgatcg ccacggtgtc gttgttgata cgcgcaccct tgcggttctt     47400
     cagccgctca agagcggcat agtagtcggt catggcgccg ctcatgctgc ctccgatttg     47460
     atcagtttct cctgcgcgtc aagcagtcgt tgcagcgcct gcgcctcgat acggtattcg     47520
     acgctcgtct catcgaccgc gcgcagcttc gcgaccgtaa cctgctgcgc gttgatcacg     47580
     cgacgaagct tcgatggcac gaccacgagg ttacggcagt ccgattcaag acaatccaga     47640
     cgcatccagt cgagtggcgt cgacttgcac tgctcgacac tggcgcagcc gcccagcacc     47700
     gtctcgcggt acgcgagctc gcccttcacg aacatcctca tcgtctgctc gcgtgagtag     47760
     accgacacag gcgaggcctg cacggcacgg ctctgcgtcc acgctgcgtg gccgccgaac     47820
     agccgcacgt cagagaacag cacctgctcg gcgtacgcaa ggtactcgga caggccctgt     47880
     gccccggccc attcgttcgc gaagtgggtc ctatcagtgt cgatgaagcc cttcgcgaat     47940
     gccgagccac gagcgtagta catgctcatc tcctgcgtga tgtgctgcag ctgacgtttg     48000
     agcgtcggca gcgtcaccag tccgctgcgg tgcgcgtata acgcgagcgt cctccgaagc     48060
     tggtgccgcg tgaacggcca ctgccgcccg accgcgtact tcggctcgtc ttcccacgcg     48120
     cggtgcatgt cgacacgctt tagttcagcg atgtcctcga ccgtgatcgt cgggaaaacg     48180
     cgctcacgaa aggcttcgat atcgttatga acggtactcg ccgcccggtt tgctacgtat     48240
     cccatatgca gtcccatccg gcagaacagc aggtgcgaac cgtccgtcga ttcggcgtag     48300
     ccctgcgcgc cgtgtgcacg gtgtgcctct cccgatagcc gttgtgcgag cccgacagca     48360
     cgggcggcga gcgggctggt cacccagcgt gcgcgcctgg gacgcccgcc cgacagcttg     48420
     gtcgtgatgc cctcgatggt gtagtgggtt acgccatcca gacgggtctc gctcaggcag     48480
     tcgtatggga ggctctctgc ttctgtcgca cgcatgccgg tgaacgacag gatgacaagc     48540
     tggcatagcg ccctgatcga cgccacaagc gacgacgcga cgtaagggac tgccttgtac     48600
     ccgaagtgtg cagctaccct taccagttct gaagggacgg acggactctc gccggcatac     48660
     agtcgtgcga ggtagtctga cagcacgtcg acgatccctt cagcgacgcc gaggtcatgt     48720
     tcacaggcca acaggaagtg ctggtagatc cgcgtcggga cgacagggtg ttgtgagttt     48780
     ccagcacgtt gcgcgaagcg ttcgagcaga ggcttgtgca gttgtgccag tggtacgcgc     48840
     agccctgtgg tcccgacgcc cagacggtga agcttcacca gaactgaatg aaggcgctgg     48900
     gccttcctct ccatcccggg ttgcgccaca tagtcgagga caatagcgac gctggacagc     48960
     ccctcgtaga gagtaagctc acgttcggcg gcaaagaacg cgaatccctt caggcaggct     49020
     gagccagagt taagcgtact ggacgccggt accgtgtcgg tcgcttcgtg catcagaaag     49080
     tagatcacct gcttccactg tcgcgtagtc gcttctgaaa gggctcgact tgcgccgtca     49140
     ggcaggtggc ccctgaagta gatatgggtg cgcggcccaa tcgtatatgc ccggatgtcc     49200
     caggcagcgt cactaaacag cgaaacagcg ttcgcagcct tgtcgcgcgt agccactgta     49260
     tcgtcctcga cacgatacca gtcggggcgc tcagcgatcg gcgcgatcag cgtgttgttc     49320
     atgccacccc caattcgtaa agctggtcga gcttggccga ccagaaagcg tccagattcc     49380
     catcgacatc aacgtcctgc tcgatctgat cgaccagcgc ggcgtcgcgc ttacgcagtt     49440
     catccagcag gaagtcaatg cggcgcagca ccgcgccgaa cgaactgtcg tattgctcga     49500
     tcgagtcggc acgtccgctc acgagcctga cgcaatgacg gcagcccagc agcttgtgga     49560
     tgtcggcggc gtcagcgtgc acgcgatact ggtcgcagaa gagacatcct tcggtcgagc     49620
     ggcagtccgg cttcacggtg gctgaagcgg cgatcggcac tggcttgcgg aattcgatgc     49680
     agacgcccac cgcgctcctg atgctgccag ccgggtcgtc gccggtcttc agcacagcct     49740
     tctcgaccga agcgaggaac acgcccatct cagccttgtg cgcggcgtcc gtgccgttcg     49800
     agtacgaacg caacgctgtt tccaccgagt gccccatcag cctggctgcg atgacagggc     49860
     cgtggttact taccgcccaa tcctgctttg ccgcacgcca ctgacgtgcg ctaatgcgcg     49920
     gcagcacgat cccgagcgtg tcgagtcgat cataaagaag ggtcagaaat tgggttggga     49980
     gaggcatggg ccgtcgtcgc tgcgggctat gtccgactac gatgaacaac gcgtcgcagc     50040
     ctgcgtcctg caccagatac tcgcgcaatg cgagatacgc cttgagcttc ggcatgaagc     50100
     ccagcgagac ggtgaacgta atctctttag cccctgcacg atacttgacc tcgcgaaact     50160
     tctgacgcac aaccgacgca tcctgcaggc tcgcggcaag ctccagactc cacttcatgg     50220
     ccagcagctg tgcgaggttg acgcccgttt cggccagaaa cagcgcggca aagcaaaaga     50280
     cggccatcga agcgtgtgag cgccggatct ctgactgcgc gtcctcgttc gccgccgcaa     50340
     gatgtttagc cgcacttctg gcgatgtccc ccgaacgctt agaagggttc ttggcttcag     50400
     cctcagccat gcgcatcgtg agttcttccc gggtgcgcgg ctctcccgtt tccagattcc     50460
     agccagccag gccgtgagag ccgtcgcctc cgcgacgatg gtgtctgcgc ggaacaaggc     50520
     aaagactctc accgcgcgct gtggtcacgt gtaccgggta cggcttgaag tcgagcacca     50580
     gcgtgctgat accgctgaag agcgcgtcag cccacgcgag cagggtggcc tgggcttcgg     50640
     cgtcaggcac cgccgtcggc accgaagcat cccgttggcg gcccagcacc ctcgcgtcgg     50700
     cgcagaagtc gtcgtttcgg aataactcac gtagcatcga caacagacgg cgctgactga     50760
     tgtcgacgga attgcgcttc aggttgccca gcgagacctg ttcgcgcctc tcacggaagt     50820
     agcgatgaac cgcttccgcc gtagtcttct cgtcacagag cacctgatgc aagccctgcc     50880
     tgtcggccca gttaacgaac tcaagcacga cgcgcaaagc accgtcgacc gtccttggac     50940
     gcatcgcgcc aagggtcatg cgcccggaaa gctgcgtcac cagcaggcgt acgaccctgg     51000
     cgcgttcact gctgaagctt gtggggtcga aagtgcgtcg cgtacaccgc aggctcgacg     51060
     cgtcacgctt caagtagcaa atctgcccga tatcggaacg tccgctcatg ccttcccacc     51120
     tgagcagcgc gcgctcggga tgtagcagtg ttgtaccctc cgcgagcggc atgcgcactt     51180
     cttcgtactg gcggctcatg cagccaccgc cgtgtcaagg gtgcgcgcga ccagcgtcga     51240
     caggtgcacg ccccagccat cctggacagc gtcgaacagc ttgcaattct cgcggtaacc     51300
     gaggtagcgc aaatgtgctg cagcacattt gcgctattac cggccgtaga tctttatgta     51360
     gagtagcaac gtcaaacgct tcgtgaagca aggcgtcttg tttgaactac tgcacataaa     51420
     gtttcatgat gggctcctgg cggccatcgg gatcgccttt gtgaggagtt cgatcatgga     51480
     gaagtcaacc cgtcaagttt caagccacct gccgttgcag cagttcgtcg ctggcgccgt     51540
     gagcgagctg gagaggctag gctacagcag gaaatcgctt tggcgctatc gcgtcgcctg     51600
     gcgtcatctc attgagtttt gtcatgagat gagcctgggc gataagtact ccctggagct     51660
     ggcgaaacgg ttttgctcta cgtatcaagt tcgtgctgac gaatgcctga actctggcca     51720
     ggggtggcgg cggaatatcg tgtttgccct caaggttctc gatggctttg cgcatgaggg     51780
     gcatattgtg cgcaccgtca ccgatatcaa gacgatacaa gttcccgaac ccatgagcac     51840
     ggcattgcgc gactatgaac tgtactgccg ggatcgccgt catcttcgta caacgaccct     51900
     tcgcgcgcgg atgcgggtga tagcgttatt cgcggatttc cttggttcaa ggaacatcac     51960
     gttttttgat caggtgcagc cggccgatct ctgcgcattt gtgaccgcgc aacatcgtct     52020
     gtcggcgaag tcagtctcgc gcatcgtttc cgatgtgcgt tgctttctgc gctttcttct     52080
     catgcgagga attctgcagc aggatctcag ccatgtattg ccggtggtcc acgttccacg     52140
     cgatgcgact attccatcgg tctgggaccc ggaagtcctg accaagctgc tcgaagccgt     52200
     tgatagaacc tcacccaaag gcaagcgcga ttacgccatc tttctgcttg cctgtcgcct     52260
     cggattgaga gtgggcgata ttcgcgcact ctccctcgac gatctgaagt gggaaacggc     52320
     cacaatagag gttaggcagt cgaagaccct cacacctctt tgtttgccat tgacggagga     52380
     agttggcgaa gcgctgattg actatctgag atcgggccgt cctcaatcgg atcatcgaga     52440
     agtgttcctc acgttgaacg ctcccttcct acccttccgc gaggccgaca gcctatattg     52500
     gatcgtccgt cattggaagg ccatcgcggg gattcacttc aggactccac aacgccatgg     52560
     tttgcactct ctacgccaca cactcgcgac acgattgctc catgaacaga cgccgtttca     52620
     agtcatcagc gacatcctgg ggcatgcgac gacagcctcg acgttgatct acgcgaagac     52680
     cgacgtggaa accctgcgca ctgccgcgtt gaacaccgag aagatgcgcc atgtctagta     52740
     gcaaattcaa ggggcatttc cagagcgctg tcggcccact catggaacag ttcgtccagg     52800
     agaaacaggc ctgtgggtac cgatataatg cgcaagcccg cttgctggca tgctttgacc     52860
     gcttcctgag cgatgaagcg ctatcggcat gcgagctacc gcgctcaatc agccgaaagt     52920
     ggaccgccaa gcggccccac gagagcaaga gcacccacga tcagcgtatc ggcgcagttc     52980
     gccaatttgc cctgttcatg tgccggctgg ggtatgccgc tgatgtgccg gatcggtccc     53040
     tgacggcaag gcgtacgagc agcttctctc cgcgcatcct gacccacgct gagattcagc     53100
     ggctgttccg cgcggctgac cagctcacgc cgaccgcact ttcgccaatg cggcatctcg     53160
     ttatgccgga agtattgcga ctactgtatg gctgcggcct gagggtgggc gaggtgcttc     53220
     acctgcgcgt ggccgatgtg gacctcgaac ggggaatcct gacggtgcgt gatggcaaat     53280
     ttcgaaagga caggctcgtg ccaccagcct tgcccctggt acagcgcctt cgagtctacg     53340
     cacaagtcat gggcgatcgc ccgtccgatg cctacttctt cccttcgcca tcagacggcc     53400
     cgttgagcca ctcgtccatc tactggctgt accgggagct gctgttgcgc tctgggatcc     53460
     cgcacgccgg tagaggcaag ggtccgcgcg tacatgatct acgccacgcg tatgccgtgc     53520
     atgcgttgct tcggtggtgc caggatggag ctgacctcga tgcgaagctc ccggtactgg     53580
     cgacctacat gggacatcag tccctagccg gaacgcagcg ctacctgcat ctgattgccg     53640
     aactgtttcc ggagatcacg gcacgtaccg gcgccgcctt tggtgatgtc atcccgcgga     53700
     ggaacggatc atgaaaccga cggatttctc catgctcgtg accagcttcc tgacgcacca     53760
     tctggccgca cagcgcaacc tgagccccaa cacgatcaag gcctatcgcg acgtgttcac     53820
     cctgctgctg cgatactgtc gtgacgtgcg gggaatcgca ctggagcgtc tgtctctggc     53880
     acagatcgac gtaggcctgg tcgaggcatt ccttgatcac ctggccaacg accggcatgt     53940
     ttcggtcagc acgcagaatc atcgcctcgc ggcattgcac gcgttcttcc gctacgtaca     54000
     gtcggaagta cccgagcgcc tgctgcagtg tcagcaggtc ctcgcgattc cgctgcggcg     54060
     acagccgcgc gccagcgtcg gttatctccc caaggaatac cttgcacagc ttctcgcaca     54120
     accggacctg cgtacgtctg agggctgccg cgatgcagtg atgttgagcg tactctatga     54180
     caccggcgcc cgggtacagg agttgattga cctgaacgcc ggggacgtgc ggctggatcc     54240
     tccagcgcag gtgcggctca tgggaaaggg tcgaaagccg cgcgccgtgc ccttgatgga     54300
     ctcgacagtc gaactgctgc tccagtatcg acgcgataat cacctcgatc gtcctgaata     54360
     cgccgacaag ccactcttcc agaaccggca aggtacacgg ttatcgcgct cgggtgttcg     54420
     ctatctcctg caaaagtatg tgattcccgt acggcgaagt caccccgact tcacgcagcg     54480
     ggtaagtcct cacagtttga ggcacaccaa gggaatgcac ctgctgcaga gtggcgtacc     54540
     gctcgagatc atccgcgact tcctcggtca cgtcgatgtg aagacaaccg agatttatgc     54600
     tcgcgcaaat cttgagatga agcgcaaggc cctcgaaaaa gccaccgacg gtgcgtcgct     54660
     tccaaagatc ccgtcctggc agcagaacaa agcgcttctc gagtggctgc attcactgta     54720
     ggactgcgga ggttgcgcac gctgtttgtt ggctgcgggc ctccccatct tgcccaactt     54780
     ttatgtagag tttctacgag cggagacctt tgctatcgcg gggctggatc cgatactgca     54840
     cataaaaact ttcggccggt aatagcgctc ggtcgtagac ggttgtacgt gccacatcaa     54900
     ctgccgcaac tgatcgagcg cccgcgtgta cttcgtctca ttcgctgtca tcgtgtcgac     54960
     catgttcagc ccgtaggtcg cgcgcagatc gtggaaactg aactcgtacc tggggttgcc     55020
     aagctgcacg cgcatcatgg gtaacagttc gtccctgatg aactggcgca cggcctgccc     55080
     tgtcttgacg tggcggcgta cctgcgggcc agtgctgacc gggcggcgcg acgcgcgatc     55140
     ctcgtagagc ggcgcaccgc gatagctgag aaagagcggc tggacgggat gatcgccgcc     55200
     gtctgccagc tggcgacgct tgcgcgcgcg atcgctgtgc acataggtgt agagccgttc     55260
     atagaaactg cgcggcaggt gcagcacgcc cttgaccccg cccttcgtgt cgatgcccgt     55320
     acccggcccg caggcgagac ggatgtcgtc gccgtgaaac tcgcccggtt tgcgcatcac     55380
     gtgtctcgcg cgcacggtca gtaccgtctg aatgcgagcg cccgtcaaca gcgcgaacag     55440
     atgaacgagc gtcatctcgg tattgccgag agtggccaac gattcaagca gcaccgactg     55500
     ctcggcagag ggcagcgggc gcaagcgacc accgtcctgg atgtgatcgt cccacgggtc     55560
     atctgcgcgc cggccactga tcgacaggtc ggtggtcttg acctcgatcg cgcggctgaa     55620
     gcccttatgg tctctgaact cgatgaagcg gccagattcg gcccacggcg cgttcgcggg     55680
     cctgaagcct gcctcggtca tgagccagcg ataaaagcgc actacggcgc ccatacgacg     55740
     cctggcgacg cccggagaca gttcgcctgc ctgcacggcc agcctgatcg aggcactgta     55800
     gcggtaggtt ggacgttgcc gcttgttcgc gggaaatgcc agccagtcaa cgccctcgtt     55860
     atccagataa cgacggaacg ccaccaggtc gtcagcaatg ctggcgaacg tcagcatgtt     55920
     gggcgacggc ttcgactcaa tcatgtcgat gagccacagg ttcgcctcag cccacggtgc     55980
     gccgtcagcg agccggacaa caggaaagag aggaaaggtg cctgtgatcc actgcgggcg     56040
     gtcgtcgcgc cgcttgccgg tgtcagggtc tgcgagtggg accgtgtgat agatcgtgcc     56100
     gccctcgggc gtggtaatgc tgaccggcgt cgcgccggat gtgttgcggt caacgacctc     56160
     ggtcaacggc agatgccgga tggtcgttcg tcttgctgtc atcgcccaga tcctcatgct     56220
     gtgtttgagt gggcgtcctc attaacacaa cgtgcgagta tcaagaaatc gttcctggct     56280
     tgcgcatacg ccaaatacct tcaggccggt gctgtcgacg accagatgca gcgactgact     56340
     ggcgcgctgc accggcagca ccacgttcag atcctgtgcg cgacggctca gggtcgagta     56400
     gttcggcacc ggcaaatcgg cgaaggcaag cttgcgcagg ctcatggcaa agccttgcag     56460
     cgcgcgcaac ggcaggcgga acacttgctt gaggccaagc agcatctgaa tgacagcatc     56520
     cgaatagacg cacgggcggc cgcgcttgga tacacccacg ccgggcgacg ccaacacgct     56580
     ttggtctatc cacatcgtga cgtctcccct tgcaatcaga ccggcgttgt attgcgccca     56640
     gttcttgacg cgataggtgc ccttgggctc ggcttgcttc tgtgtgtccc tgcgcatctt     56700
     cccggcaaaa gacgagaatc tacgcacccg gcccgattgt ttacagcgct atctgctcag     56760
     accgttgcgc gtaaacgtca actcgccgtg cgccgggcgg atttgtgcaa caacgcccct     56820
     cgcatgccat gtcgatcgaa acttgcatgg caacctgttg gtagtgtttt ggaaagctac     56880
     ctgaagtcca tgtgctggcc attaggggct acgaatggga gttgcaaatc ggcttgacag     56940
     agcacgccaa aaataatctc cattctgcaa caagttactt cgattacgct gcaacgcggc     57000
     gttaatggga tggacgcccc tacccctaac ggtatcgata tgccaaagtg ggagcgcata     57060
     gcaacccctt gacacaagca ggagcgttca ccatgaagac ttgttgacgg cggtctaatc     57120
     gcgacagtaa acggcggcgc aaggttggta aaagcgtcaa cagcaagggg cctagagcgg     57180
     ccccttgctg ttcgggttgg cgaatcctga tcagaacggt tcgtccatgt cgtcgggggg     57240
     atggtccgag cagggcgaac gctcgtcgcg cagcaggtcc tctagtccga actttgactt     57300
     cccaaatagc cggaacccac ctcggcgctg ggtttcggct atttttgaga ctattatgta     57360
     accatgtaag ttagtattga tatattgcgg gtcagtagtt ttgtgcttga ataagtgttc     57420
     atgtatatcg aacacgtccc gaaccgcaac tcgccccccg ccatcctgcc gcgcgagtcc     57480
     tatcgcgacg gcaacacggt caagaggcgc accctcgcca atctctcgtc gctgcctgcc     57540
     gaggtcattg aaggcttgaa ggtgctgcta cgcggtggcg tcgcggtgtc gtccgccgat     57600
     gaggccttcg tgatcgagcg cagcctgcca cacggacacg tggccgccgt gcttggcgcg     57660
     gcgcgcgcct gcggcgccga gcagtggttt gcatcggcac cggccgcgct gcgctcggtg     57720
     gtgatcacag gaaggttgat tccacctcgt atttcgccgg cttcacggac ttgccttgca     57780
     tctcgtcgcg cttgtccacg cccgtgtagc ccgcatcacc aaatgcatgg tcttcgtggc     57840
     catgcagcaa ggcatgcgcc tgcgatacat ccgagtcgtt cgctgctgtg cccaccacgc     57900
     tgtgcactag cccagaagcc gcatccacgc cgaggtgggc cgtcatgcca aagtgccatg     57960
     cattaccctt cttggcctgg tgcatctccg ggtcgcggct cttctccgtt cttggtcgag     58020
     ggtggcgcct cgataatggt ggcatcgaca atcgtgcctt ccttcatcat cagcccccgc     58080
     tcgcacagca tgatgccgat ctcttcgaac agctttcgcg tcagttcatg ctcgacgagc     58140
     aggcggcgaa acttcagcag cgtggtcgcg tctggcaccg cttcgacggc caggtcgatc     58200
     ccggcaaagg cccgcatcgc catgctgtcg tacagcgcgt cttccagcgc ctcgtccgac     58260
     agcccatacc actgctgaag gaagtaaatg cgcagcatcc gctccagtcc gatcggtggc     58320
     cgctcacgtt tgcccttggg gtagtacggc tcgaccgccg caatcaggcc cgaccacggc     58380
     accacgctta ccatctccgt caggaagcgc tggcggcgcg tcacccgctt cttgccgtgg     58440
     ccttccgctt ccacaaaact gatctgtcgc ttcatctccg gctcatctct tgggcgtgcg     58500
     catgacaacg cttacaagcc actcatcaat gaatgcccgc gctaaatcag tttttcctta     58560
     gtggtgaggt caggtaacgt gccaacgtcc gccgcagcga tcaatcggcc ggctgtagct     58620
     tgtgcgccag agcggacatg ctccatacca ggatgaacgt gcccatgatg accagtccgg     58680
     ccaggccgaa ttcgtcgttc gccttgccca attgcagcca gaaggcactg cccgattcga     58740
     ggcgggccgc cacgcctgtc acctgtacga caccaaccac gatcgcgatg atcaccgaca     58800
     ggaacgtgac actcatgttg tagtacagct tgcggacggg ctggtccagc gcccagccgt     58860
     acgcaccgag catcaggatg ccgtcggtcg tatcgaccag cgccatgccg gcggcaaaca     58920
     gcagcgggaa cagcaggatc gatgcgaggg gcaggtcctt cgacgcctcc gtcgcggcaa     58980
     tgccgagcag gccgatctcc gtggcggtat cgaaaccgag cccgaacagc aagccaagcg     59040
     gatacatgtg ccagctgcgc gtgaccatcc ggaacatcgg ccggtacagg cgcgccagca     59100
     ggccgcggcc attgagcagg cggtccggct cctcggcggc gccggccttg ccggtgtgca     59160
     actgccacca ggtccggcac agcgagcgca gcaccacgag gttcatcagg gcgatggcaa     59220
     tcaggaagcc ggccgacacc cctataccga tcatgccgcc gatttcgcgg aacggaccgg     59280
     tgcgctggtg cagcgcggag gccgccatga cgatcgcgat ggagccgaac agcacgaccg     59340
     tcgaatgccc cagcgagaac atgaagccca ccgccaacgg tgtcttgtgc tcctgcatca     59400
     atttgcgcgc gacgttgtcg atggcggcga ggtggtccgt atcgacggca tggcgcaggc     59460
     ccagcgtgta ggccagcagc gcggtcccca gcagcatcgg gttgcggtga aaggcgaaga     59520
     tggccaggcc ccaggcgcca acgttgactg ccagcaggac cgcgtagatg tcccgtgtcc     59580
     tggaccgcgc gtcgacctgg gagtcgtcta gcaggcatga caggattggt ctcatagggg     59640
     gggccttatt accgtggcaa ttcccttaag ttaggcgctt ttgccccaac cttcgacgcg     59700
     gatattgcga tgcagcatgg cggcccgctg caggcgggac acggttgcac cgtggctccc     59760
     cggatcgaga tcgctgtcct atactcgtga ggtatttata ggcccatcac ggtgggcaag     59820
     agttactgtc cccgcagcaa acgtgacttt ctgcgccatg gttggcggcg cttcgctcgc     59880
     ttgctggatc cgtggatgcc gtgcatcgat cccacgggtc attgagagtc aaagaacgcg     59940
     gtcagcagtg cgaggcagat catggcagaa caggccgttc cctatgggcg caagactcag     60000
     cacacgcccg ccctcaagga agtccatatc ctctggatca ccgccggtct tggctgcgac     60060
     ggcgattccg tttccattac ggcagcaagc cagcccagcg tcgaggacgt ggtgcttggc     60120
     gcgattcccg gcctgccgaa ggtgcatctg cataacccgg tcctggccta tgaaaacggc     60180
     gacgaattca tggcgccgtt ccacaaggcc gcccgcggcg aaatcgataa cttcgtgctg     60240
     gtgcttgaag ggtccattcc caatgagcgc atcaacggcg agggctattg ggcggcgatg     60300
     ggcaccgacc cccagaccca ccagcccatc acgattcccg aatggctgga ccggctcgcg     60360
     cccaaggcgc tggccgtggt gggggcgggc acttgcgcca cctatggcgg catccacgcc     60420
     atggaaggca atccaaccgg ctgcatgggc ctggcggact acctcggctg gcagtggaaa     60480
     tcccgtgccg gcctgcccat cgtgaacgtc ccgggctgcc ccgtgcagcc tgataacttc     60540
     atggaaacgc tgctgtacct cttgtaccag ctggcgggcc tcgcgccgat gatcccgctg     60600
     gacgaggcgc tgcgcccgaa atggctcttc acgcgcaccg tgcacgatgg ctgcgatcgc     60660
     gccggctcgt acgagcaggc catcttcgcc accgagtacg gcaacccgaa ctgcattgtc     60720
     aagcttggct gctgggggcc ggtggtgcaa tgcaacgtac caaagcgggg ctggatcgcc     60780
     ggcgtcggcg ggtgtcccaa cgtgggcggg atctgcatcg gctgcaccat gccgggcttc     60840
     ccggacaagt tcatgccgtt catggatgcg ccgcctggag ccgtgctgtc gtcgaacctg     60900
     atcaagagct acggcccgct gattcgcagc ctgcgcaagc tgaccaagga cacgctcaac     60960
     gatgagccga agtggcggca caaccagcca gttctcacta ccggctaccg cggataagcg     61020
     gcgggaacgc gcattctaag atttggaggt ggtcatggcc acaatcgctg ctcctggtgc     61080
     caggccgcgc gcccaagccg cgccgggcaa gctggtcgag atgaactggg atccgatcac     61140
     ccggatcgtc ggcagcctcg gcatctatac caagattgat ttcgagaacc gccgcgtggc     61200
     cgaatgctac agcacgtcgt ccatcttccg cggctacagc atcttcatga agggcaagga     61260
     tccgcgcgat tcccacttca tcaccagccg catctgcggc atctgcggcg acaaccacgc     61320
     cacctgctcg gtctacgcgc agaacatggc ctatggggtg aagccgccgc ccatcgcgga     61380
     ttggatcatc aacctgggcg aggcggccga atacatgttc gaccacaaca tctttcagga     61440
     caacctggtc ggcgtggatt tctgcgagca aatggtccgc gagaccaacc ccggcgtgtg     61500
     ggagaaggcg aagaccgcag aggcgccgca cgcggccgag catggctatc gcactattgc     61560
     ggacatcatg acggcgctca acccgtttac cggggagttc taccgcgaga cattgctggt     61620
     cagccggtat acgcgcgaga tgttctgcct gatggaagga cgccacgtgc acccgtccac     61680
     gctctatccc ggcggggtgg gcaccgtgcc gaccatccag ctgtttaccg actacatcac     61740
     gcgcctgatg aagtacgttg aattcatgaa aaaggtggtg ccgctgcacg acgacctgtt     61800
     cgacttcttc tatgaagcac tgccgggcta cgaggaggtg ggccggcgcc gaatcctgct     61860
     cggctgctgg ggatcgttcc aggatccgaa cgtctgcgac tacaactacc gcaccatgac     61920
     caaatggggg cgcgggatgt tcgtcacgcc cggcgtggtg gtcgacggcg aactcctcac     61980
     gacggacctg gtcgacatca accttaatat ccgcatcctg ctcggcagtt cgttttacca     62040
     ggactgggat catgaggaaa cctccgtcaa gaacgacccg ctcggtaacg cggtggaccg     62100
     caagcacccg tggaaccaga ccacgctgcc gcgcccgcag aagcgcaact tcggcggcaa     62160
     ctacacctgg gtgatgtcgc cgcggtggct ggacaagcgc accggcgacc atctcgcgct     62220
     ggataccggc ggcgggccga tcgcgcggct atgggccacc gcgctggcgg ggctggtcga     62280
     tatcggatac atcaagtcca ccggccacag tgtcaagatc tacctgccga ggaccgcgct     62340
     taagccggaa gccgagttcg agtggaagat cccgatgtgg agcaacgcca tcgagcgcga     62400
     tcgggctcgc acctacttcc aggcttactc ggcggcggct gcgctgtact tcgcggaaca     62460
     ggccctggcc gagctgcatg caggccgcac ccgcacgttc accgatttca aggtgcccga     62520
     cgaggcaatc ggctgcggct tccatgaggc ggtacgcggc gtgctctcgc accacctggt     62580
     catccgcgac ggcaagatcg ccaattatca tccgtatccg ccgaccccat ggaacgcgag     62640
     cccgcgcgac atctacggca cgcccggtcc ctacgaggac gcggtgcaga acacgccgat     62700
     cttcgaagag aacgggcccg agaagttcaa gggtatcgac atcatgcgcg cggtgcgcag     62760
     cttcgaccct tgcctgccgt gtggcgtgca tatgtacgtg ggcaacggca agaccatcga     62820
     gcagtcgcat tctccgacct tcggcgtgat ggcgggggcg cactgatgag cggtgcccgc     62880
     acggtccagg cgcagcagca gcgcatcgag gcgatgatcg cggcactgga gagcgtggac     62940
     gacaaccagg ccagcgcact cgcgagggaa ctgctgcggg tggtgcttga tctgcatgcg     63000
     ggcgggctcg cgcgggtgat ggagatcgtt tccatggcgg gcatccagga caatccggtc     63060
     gtcgaagcac tggtacggga ccctgcagtc tgcgcactgc tcaacctgca cggcctgcat     63120
     ccgcacgacc tgcccacacg cgtggcgcgc gcggtggagc acatgcgggc cgcgctgggc     63180
     acccagggcg tgacgatcga actgcgcgat gccgccgagg aagccgtgcg cgtgcaggtg     63240
     tcagggcggc tgcaaggcaa gcacgcgtcg cccgagtcgc tgcggcaaga gatcgagcag     63300
     gccatcttcg agcaggcgcc ggaagtggtg cgtgtcgaga tcgccggatt ggccgacatc     63360
     gacgtgcacg aactgcgctt tgtcccggcc agggagatgc gcggcccgga caggcaaggc     63420
     cgggtcgggg gtggccagcc atgagcgcgg gaccgttccc cgaggcgcgg accggcgtac     63480
     aggggtgcgg cggctgggtg gcgcgcctgc gccagttcac gcgcaaggcc gactacgcgc     63540
     aatgcgagct gtgcggcgcg tccatcgtcg cggaccatgc ccatctgttc gacaccacgc     63600
     ggcgccaatt gcactgctgc tgccgggcat gcgcgctgct gttcggcagc cagcagggat     63660
     cccgctatcg cccggtgcca cgagcaggcc gctatctgga tgggttccgg atgagcgacg     63720
     cacagtggga cgcgctggcg atccccatcg acgtggcgtt cttcttcgtt gactcggggg     63780
     ccgcgcacgt cgtcgcgctc tatccggggc cggccggtgg cacgcgctcg cagctcggcc     63840
     tggcggcctg ggacgacctc gttgccgaca atcccgacct cacgcgcatg cgtcccgacg     63900
     tggaagcgct gctcgtctat cgcgcgcaag gcgccaggga ctatttcctc gcgcccatcg     63960
     accagtgcta tgcgctgacc gggctgatcc gcgcgcgctg gcgcggcctg tcggggggca     64020
     agccggcgtg ggaggcgatc cggggcttcg ttgccgcgct caaggcaacg ggccgcgtgc     64080
     cggagggcct gctccatgcc tgacctaacg ttcagcatca gcgcggccga ggtggcgccg     64140
     ttcgccgccg tgccgctgct gctgttcaag ctgcagatcg cgaacgcgcc cgccggcgag     64200
     gagatcgcca gcatcacgct gcaatgccag atccagatcg aggcgacccg gcgccgctat     64260
     gcgcccgccg agcacgatgg cctgcaagac ctgttcggcg tgccgcaacg ctggacgcag     64320
     accctgcgca cgatgctgtg gacgcatgca accgtgatcg tgccagcgtt ctcgggcacc     64380
     tgcgtcatcg acctgctcgt gccgtgcagc ttcgacttca acatcgcggc gaccaagtac     64440
     tgccatgcgc tgcaggacgg cgagatcccg ctaatgctgc agttcagcgg caccgtcttc     64500
     tatcgcaacg cggacgacgc gctgcaggcg gcgcccgtgc cctggcacaa agaggccgcg     64560
     ttccggctgc cggtggcggt gtggcacgac atgatggcgc gctattaccc gaacggcgcc     64620
     tggctgtgcc tgcagcgcga agtcttcgac cggctcggcc gctacaaggc gcagcagggc     64680
     ctggcgacct gggagcgggc gctggacgcg ctgctcgacg gcgccgagga gaaggcatcg     64740
     tgaaccaggt cgacagcgtg atccaggcgg tgctctacga gggctacatg ctgtatccct     64800
     accgggcgtc ggcggtcaag aaccgccagc gctggacgtt cggcggcgtc tatccgcgcg     64860
     cgtattcggt ggcgtcgggc agcgatccct ggatgacgca gaccgaatgc ctgctgtgcg     64920
     gcgacgccga tgcacgtgtc acggtggcac ccgggttcct gcaggtcgcc gaccggaccg     64980
     tgctggccgc gtcggaggac ctctcggaag gcggcaccgg aaacacaact ccgtggcggg     65040
     tggtgccggt gctggacgtc gacgatcgcc gctttcatcc gtggcaggaa gccgtcgagc     65100
     ggcggcttgc gctgccgtcc atgcggctgg gcgagctgct ggatgcgtct cggatcgaac     65160
     cgttcgcctt tgccgggagc gccgagatcg agttgctggc cgatcgcgaa ggcgtggcac     65220
     gcggcgcgct gcgccgcacg catgccgcgc tcgtcggcca tgtgggggtg ggcgccgagc     65280
     gggtcgatga ccgcgtgtgc aggctcaccg cccgcatcgt caacctgacg ccgctggcgg     65340
     acgcaggggc gctcacgcgg gacgccgcgt cggtgtatgc gctggtatcg tgccacatgg     65400
     tactgtccct ggagcaaggc tggttcctgt cgtcgatgga tccgcctcgc gcgctcgccg     65460
     aggcgtcggc agcgtgccgc aacatcggca catggcccgt gctggtcggt caggacgggg     65520
     aagagggcga gggcgggcat cgcacgatgc tggcgtcgcc gatcatcctc tacgatttcc     65580
     cgcagatcgc gcccgagagt gccggcgacc tgttcgacgc caccgagatc gacgaaatcc     65640
     tgacgctgcg catcctcgcc atgaccgacg acgagaagcg cgagatggcc gccaccgacg     65700
     agcgcgcgcg cgcgctgctg gcgcgcaccg agcagctcgg gacgcagcag ttgcagaagc     65760
     tgcacggcgc catgcgccac atccgcgggg gcgcggaatt gaccgaggtg ccggacctgt     65820
     ccggcgatcc cggcgcgctg aacgaatccg gcacgccttc ttcgccatgg gctggccttg     65880
     atgcaggccc gcgcctggcc tgcctgcggg tcggtggcat ggagattcgg gtgggcgacc     65940
     acgttcggct ccggccgcgc tcgcgtgcgg acatcttcga catggccctg aacggccagt     66000
     tggccaccat cgaatccatc gagcgcgatc tcgaagatcg cgtgcacgtg gccgtgaccg     66060
     tcgactgtga ccccggcaag gactttgggc tcgcgcgcat gccgggacat cgcttcttct     66120
     tccgcccgga cgagatagag ccgctgggcg gtgcggaggc acaggcatga gcggcatcct     66180
     ggtcgcgggc atcggcaatg tattcctcgg cgacgacggc tttggggtcg aagtggtgca     66240
     gcgcctcggc gcccgccagg ccgcgcatgc cttgccgccg tttcccgaag gcgtagtggt     66300
     ggccgacttc ggcatccgcg gcatcgacct gtgctacgcg ttgctcgacg gggtggacgc     66360
     cgccatcctg gtcgatgcca cgcaacgcgg cggggcgccc ggcagcctct atgtgatcga     66420
     gttgccgatg gacgcgcagg acggcgacgg cgctggcgat ccgtacgcgt cacctgtgct     66480
     gatgtcgccg catgagatga atccggccct cgtgctgcgg gcgctgcgga tgatgggcgg     66540
     cacttgcgcg gacgttgtgg tgatcggctg cgagcccgcc gacttcgggc tcggcgaggg     66600
     cgaagagggc cggctcggcc tgagcgagcc ggtggcggca gcggtggacc gcgccgttgc     66660
     aatggtcgag gcaatggtcg ggcgcaaggc cgagcaattg tatggacggc cggcgtaggc     66720
     gcggtggtcg tgttccttgt gcaggaggca tcatgaaagg ctttctcaag tacctggtcc     66780
     tgccggcgct ggtggtcgcg ctgttggcca atataaagga catccggcgt tatatccgga     66840
     tacgcagcat gtagctgcgc atcgcgcaga ccaaaggcac gccatgcaag cctgtgcact     66900
     gccagtccgg gaccggtccg ccgcggtacg gccacgcggc gaggagatcc gcgtgcgcgg     66960
     catggtgcag ggggtcgggt tccggcccac cgtatggcgg ctcgcacacg attgcgggct     67020
     gtccggctcc gtgcgcaacg acagcgatgg cgtgcagatc cgcgcctggg gcgacgccgt     67080
     ggcgctggac cgcttcattg cgcggctgcg ggacgagtgc ccgcccctcg cgcgcatcga     67140
     cgccatcgag cgccgcgtcc tggcgcagga tgccgagggc gcggacctgg gtggctttcg     67200
     cattgttgcc agcgtgggcg ggccggtgcg gaccggcgtg gtaccggacg ccgtggtctg     67260
     tagtgcctgc atcgccgata tcggcgaccc gctgaaccgg cgctatcgct atccgtttgc     67320
     caactgcacg cattgcggcc cgcgcctgtc gatcgtgcgc gcgattccct acgaccgcgc     67380
     caacacggcc atggccgcgt tcccgatgtg cccggcgtgc cttgccgagt atgaagaccc     67440
     ggccgaccgc cgcttccacg cgcagccgct ggcctgcgcg gcctgcggac cccacgtgtg     67500
     gctcgagcac acaggcgggc cgctggccgc cggcccagac gacgcgatcc gcgcggcgtg     67560
     ggcgctcctg cgcgacggcg ggatcgtcgc catcaagggc atcggcgggt tccagttggc     67620
     ctgcgatgcc tgcaaccccg tggcggtggc gcgcctgcgc cagcgcaagc ggcgcgagcg     67680
     caagccgttc gcactgatgg cgcgcgacct ggcggtgatc cgccaataca gcgagccgac     67740
     cgcggccgaa tgtgggttgc tgcaaagccc ggcggcaccc atcgtgatcg tccagacgcg     67800
     cagcgaccgg cagggtgcgc ccctggcgcc cgacgtcgcg cccggcatcg ccgcgctggg     67860
     gttcatgctg ccgggcacac cgctgcactg gctgctgatg gcgatggccg accgcccgat     67920
     cgtgctgacc agcggcaacg ccagcgacga gccccagtgc acggagaacg ccgacgcgcg     67980
     catgcgcctc ggcgcgatcg ccgatgcgtt cctgatgcat gaccgtgacg tggtccggcg     68040
     cgtggatgac tcagtcgcgc gcgtcgtgct ggacgtgccc cgggtgatgc ggcgctcacg     68100
     cggatatgcg cccgcgccgc tgccgttgcc gccgggcttc gctgccgcgg cgccggtgct     68160
     ggccatgggc ggcgagctca agaacacgtt ctgcctgatg cgcgcgggcg aggccatctt     68220
     gtcccaccat atgggcgacc tggaagacgc gctgacccat gccgactacc gccgcgcgct     68280
     gacgcaatac atggcgttgt tcgagcatgg cccgcatctg gtcgcggtgg acatgcatcc     68340
     cgaatacctg tccggcaaga tcggccgcga cctggcacgg caggggcagc tgccggttgc     68400
     gcaggtgcag catcatcacg cgcatatcgc cgcgtgcatg gcggagaacc gcgtggccct     68460
     ggccgccggc cccgtactgg gcgtggcgct ggatggcatc gggtacggtg tcgatggcag     68520
     tctatggggt ggcgaattcc tgttggcgga ctaccgggac ttcacgcggc tggcctgctt     68580
     caagcccgtg gggatgcccg gcggtgagcg cgcgatccac cagccgtggc gcaataccta     68640
     cgcacatctg gccgccgcgg tcgggtggga taccctgatc gcccggcatg ccagcctggc     68700
     gcttgtacgc ttcctggcaa cgcgcccgcg cgaggtactg gacgccatgc ttacgcgcag     68760
     catcaacagc ccgctggcca gctcggccgg gcggctgttc gatgcggtgg cggcggccgc     68820
     tggcgtctgt cccgagcggg catgctacga ggggcaggcc gccatggagt tcgaagcgct     68880
     ggccgatcgc cgcacgctga gcgaggaaga cgatggccgt gcctatccgt tcgccatcgt     68940
     gccgggcacg ccggcctgcc tggagccggg cccgatgtgg gtggccctgc tggctgacct     69000
     ggcgcgcgct acgccggcgc cgctgatcag cgcgcgcttc cacaaggggc tggcgatcgc     69060
     catcgcgagc atggtcgcgt acctggcgga ctgcccgggc gcggggtgcc gcgcggtgcc     69120
     ggtggccctg tccggcggtg tgttccagaa ccgcatcctg ctcgaacagg tcgccacgcg     69180
     gctttccgcg caaggccgcc gcgtgctgac gcacagccag gtacccgcca atgacggcgg     69240
     cctctcgttc gggcaggcgg ccatcgccgc cgcgcggtcc ctgggaggcg cagacgttgc     69300
     aggccaggca aacgcgggct atcggagtac aacatgtgcc taggtatccc cggacagatc     69360
     ctggaagtgc gcgacgccgc caatgccttg gcgatggtcg aggtcggcgg cgtgcggcgc     69420
     ctgatcaata tcgccttcat cgtggacgac gaccacaagg ccgaggcttg tgtgggtgaa     69480
     tgggtgctgg tccacgtggg ctttgccatg agccgcctgg acgaggcgga ggcggcgcgc     69540
     acgctggcgc tgctgcatga gctcgggatt gcgcaggccg agttcgacga gatgcgcgcg     69600
     gggtcgccgg ccccgccata gcgggcgggg gcaggagaac agggcgggag caaggctggg     69660
     acggcaggaa tcacgtagca aggagacgcg gcatgcccgg ggaaacacca ctgcaagggc     69720
     tgtatccatt cctgcacggg gagcggcagg acggcgccag gcttgacgca gccttactcg     69780
     cttccgtgca gcagaaggcc agcgacagca ttgacgccaa gcgccgcttc ttcgagcaga     69840
     acgggcccgt ggtggtggcg gtggcccagg caattgcctt gacctaccgc aacggcggcc     69900
     ggctgtttgc catgggcaac ggcgggtcga gctgcgacgc ggcgcatatc gcggtggagt     69960
     tcctgcatcc cgtcacggcg ggtcggccgg cgctcgcggc cgtcaacctc gtcgcggata     70020
     cggcgatgat gaccgcagtt gggaacgacg tgggcttcgc ccacgtcttc gtgcgccagc     70080
     tggtggcgca ggcgaggcgc ggcgacgcgc tgatcggtgt ctcgaccagc ggcaactcgg     70140
     aaaatctgct cgcggccttc gccaagggca aggagatggg tctggcgacc atcggcctgt     70200
     ctggtcacga cggcggccgc atggcggcga gcgcggacct cgatcactgc ctggtggtgg     70260
     acagcgacag cattcaccgg gtgcaggaaa cccatgttgc gatctaccac atcctgtggg     70320
     atctggtgca cacgttgctc gccgaggacc gcggcgggct ggccgcagga ggcgcgcgat     70380
     gaagtacgtc gacgaattcc gcgatcccgc caaggcgcag gcgctggcgc gggaaatccg     70440
     tgatctggtg gcaggcatgg gccgcgccag gcggcgcccg ctgcagatca tggaggtgtg     70500
     cggcggccat acgcatacga ttttccgcta cggcatccag caactcttgc ccgacgaggt     70560
     ggagttcgtg catggcccgg ggtgcccggt atgcgtgctg ccgatggggc gcgtcgacga     70620
     ctgcgtggcg ctggccgagc gccccgaagt gatattcaca acgttcggcg acgccatgcg     70680
     cgtgcccggc tcccgcaaaa gcctgctcaa ggccaaggcg gatggcgccg atgtgcggat     70740
     ggtctactcg ccgatcgacg cgctggcgct cgcgcgcaac catccggacc gcgaagtgat     70800
     cttcttcggc ctgggcttcg agaccaccat gccgagcacc gccatgaccg ttctgcgcgc     70860
     gcgggccgag ggcgtgcgca acttctcgct gttctgcaac cacatcacga tcatcccgac     70920
     catcaaggcc attctcgatt cacctgacct gcagatcgac ggcttcctcg gtccgggcca     70980
     tgtcagcatg gtgatcggca cgcaaccgta cgagtttatc gcccggcact accgcaagcc     71040
     gatcaccgtg gcgggcttcg agccgctgga cgtgctgcag tcgatgtgga tggtcctcag     71100
     gcagatcgcg cagggccgct gcgaagtgga gaaccagtac ggacggatcg tgccggcagc     71160
     gggcaatgcg caggcgctgg cggcgattca ggaagtgttc gagctgcgcg agttcttcga     71220
     atggcgcgga ctgggctcga tcgacttctc gggtgtgcgg atgcgcgagg cattctccgc     71280
     gttcgacgcc gagcgcaagt tcaccgtgcc cgacgtcaag atcgccgacc ccaaggcctg     71340
     ccagtgcggc gaggtgctca agggcgtgat caagccccat caatgcaagg tgttcggcac     71400
     cgcctgcacg ccggagtcgc cgctggggtc gctgatggtc tcgagcgagg gcgcctgcgc     71460
     ggcgtactac cattactgcc gcatcgacac ctcccggctc gggcgacatg gcgcgcgagc     71520
     ggccgggcaa acggcaacca gggatgcggt tgccaacgag cgggccgcag ccggagccgg     71580
     ccatgaatga ccgtgttccg gtcccgccgg cacgcgcggc gcgcgtgcgg gacacgacca     71640
     tcaacctgac ccacggaagc ggcggccgag cgatgcgaga cctgatcgaa gacgtgttcg     71700
     tgagcacctt cgacaatccc gcgctggccg cgctagagga ccaggctgtg ttcccgctgg     71760
     tcagcctggc agcccacggc gaccggctgg cctttaccac cgacagctac gtggtagatc     71820
     cgctgttctt tcccggcggc gacatcggta cgcttgccgc ggcgggaacc gtgaacgacc     71880
     tcgcggtgtg cggcgcgacg ccgctgttcc tgtcgtgcgg cgtggtgctg gaggaaggct     71940
     tgccggtcga caccttgcgc cgggtcgcgg ccagcatgca gcgcgtcgcg cgggcagccg     72000
     gcgtcgcgat cgtcacgggc gacaccaagg tggtcgagcg cggcagcgcg gacaagctgt     72060
     ttatcaatac ggccgggatc ggcgtggtgc gcgcggggct atcgatctcc gcgcgccatg     72120
     cgcgtgcggg agacgtggtt ctcgtcaatg gctatcttgg cgaccatggc gcggcgatcc     72180
     tggtggcccg ccagcaactc gcacttgagg ccgacctgca aagcgactgc cgcccgctca     72240
     acgggctggt cgccgcgatg ctcgacgcct gccccgatat ccactgcttg cgcgacgcca     72300
     cgcgcggcgg cgtggcgaca gtgctcaacg agttcgcgca ggcctccggc gtggccatcc     72360
     gcatccgcga ggtggacgtg ccgctgcgcg aggctgtcaa gggagcgtgc gagatcctcg     72420
     ggctggatcc gctgtacctg gccaacgaag gcatcctggt ggccatagtg ccgccggagg     72480
     atgccgcgcg cgtgctggcg gccatgcgcg cgcatcctga tggcaggcag gcggcggcca     72540
     tcggcgaagt ggagccgggg ccggcggggc tggtggttct gcacaccggc tttggcgggc     72600
     agcgggttgt ggacatgctg gtgggcgagc agctgccgcg gatctgctga gtggccgcac     72660
     ccggtggaca gcaagcgaag gccgacatgc acgaactaag tatcgcgaac agcgtggtcg     72720
     agatctgtgc cgagcaggcg cggggcgcgc gcgtgctctg ggtgcagctc gagatcggcc     72780
     ggctatgtgc ggtgatgccg gatgctatcc ggttctgctt cgacgtgtgt gcgaaggata     72840
     cggcggtgga aggcgcggag ctggagatcg tggagactcc cggcgtggcg cgctgcttgg     72900
     cctgcggcgc cgagttggag atcgcggtgc cgttcgggca gtgcgcgtgc ggcagcgaga     72960
     acctggagtt gatctccggg cagcagttga agatccggcg catggaggtg gcgtgatgtg     73020
     cacgacttgc ggttgcggcg atacgacggg cgcagtggtc tcgggcccgg cagcagaagg     73080
     tgaaccggcg ccaacagccg gcgcgggaca ggacgtggtg catgcgcatc cgtatccgga     73140
     tgccatgtca cccgggcccg cgcaggaggc cggcggcatg gtgttgcgca agcatcccgc     73200
     cgacgatcat gccggccacg cgggtgccct cctgcatgcg cccatgcatc ggcgtgccat     73260
     gcattaccac gaccatccgc tcgagcatgc gcacgctcat tcccacgaac acgcccacga     73320
     acatgctcac gaacatgctc acatccacgg cacctccgtc gtcatcgagc aggacatcct     73380
     cgccaagaac cagtggatcg cgcagcgcaa tcgcggctgg ctggcggggc gctccattgt     73440
     tgcgctgaac ctcgtcagtt cgccaggggc cggcaagacc acgctgctgg aacgcaccat     73500
     ccgcgacctg ggcccgacgc tggagttgac ggtgatcgaa ggggatcagg ccacgctgaa     73560
     cgacgcgcag cgcatccgcg cggccggctg ccgtgcgatc caggtcaata ccggcacggg     73620
     ctgccacctg gatgcagaca tgatctcgcg cgcgctgacc gctctcgatc cgccgccgca     73680
     ttcagttgtc atgatcgaga atgtgggcaa ccttatctgt ccggccctgt tcgaccttgg     73740
     ggagcaggcc aaggtggtga tcctctccgt gaccgaaggc gaagacaagc cgcttaagta     73800
     tccacacatg ttccgtgcca gcagcctgat gctgatgacc aagacggacc tgctgccgta     73860
     cgtgagcttc gacgtggcac gctgcctcgc ctgtgcgcgc caggtcaatc cggacatcgc     73920
     gatcctacag gtgtcggcgc tgtccggcgc gggaatggat gactggtatc tctggcttcg     73980
     taccgcctgc gcagggcgta tcgcgccgcc tgaggactcg tttccggcgt gaccagggca     74040
     tcgctgggcg gcacgtaccg ggtcgtgact gtacaaatgg agtgatccat ctgtcagaaa     74100
     tgccaggttc atggtgtagc gcgccacgcc gtcgcggcgc tcacgcgctt ccgtgtgaag     74160
     catcatgagg tgatgccttg cctacctgcg ctagcgagca tatcgggaca taccccagag     74220
     tcatgacgat tgaaagctgg ctgaaagatc ggctcactac ggttcgaccc atccctgcca     74280
     gcatgcgtct gcatgccagg aacaccctgc gcctgaggct gcgcgcagtg ccgcatttca     74340
     agtactttga ggagtatcgt tttgcgccta cgcagcccaa aggattagcc tccggcctga     74400
     tgttcatcct ggtcgggttg gactgtggcc ggctttcatt actggttaag gagtcggcca     74460
     aaaaatggaa ctattcgaac acctggccct tggattctcc acggcgctaa cgctgcagaa     74520
     cctggccaac tgcttcctcg gctgcgtgct cggtacgcgt gctgccgggc atcggtccgc     74580
     tggccaccat cgccatgctg ctgccggtga cctacacgct gccgccggtg gccgcgctga     74640
     tcatgctggc cggtatctac tacggcgcgc aatatggcgg ctccactacc gccatcctgg     74700
     tcaacctgcc gggcgagtcg tcatcggtgg tgaccaccat cgatggctac cagatggcgc     74760
     ggcggggacg agcgggggtg gcgctggcca ccgccggcat cggctccttc ttcgccggct     74820
     gcgtgtctac actgatcctg gcagcgtttg ccacgccgct gtcggaactg gcgttcaagt     74880
     tcggccccgc cgagtacttc tcgctgatgt gcctgggcct gatcggcgcc gtagtgctgg     74940
     cctccggttc gctcccggag gcggtggcaa tgatcgtgct ggggcttctg ctgggcctgg     75000
     tcggcaccga cgtgaactcg ggcgccgcgc gtttctcctt tgatgtccct gaactgaccg     75060
     atggcatcga cttcgtcgcg ctggccatgg gcatgttcgg ctttgccgag atcatcgcca     75120
     acctcgaaca gaaagaacac cgcgagacct ttaccgatca cgtcaccaat ctatggccct     75180
     ccaaggcgga cttcaggcgc atggcacccg ccgctgcgcg gtaccgcgct aggctccatt     75240
     ctgggcatcc tgcccggcgg cggtgcggcg ctggcttcgt tcgcagctta ctcgctggaa     75300
     aagaagacct cgaagtactc gcaagagttc ggcaagggcg ccatcgaagg cgtggcaggt     75360
     ccggagtcgg ccaataacgc cgcggcgcag acctccttta tcccgctgct gacgctgggc     75420
     attccgccca acgccgtgat ggcgctgatg gtgggcgcga tggccatcca caacatccag     75480
     cccggcccgc aggtgatgac cagcaacccc gcgctattct ggggcctgat cgcctcgatg     75540
     tggatcggca acctgatgct gatcatcctg aacctgccgc tgatcgggat ctgggtgaag     75600
     ctgctgcaag tgccttaccg ctacctgtac ccggccatcc tggtgttctg ctgcatcggc     75660
     gtcttctcgg tcaacaacca gaccttcgac gtcttcaccg cggctggctt cggtgtgatc     75720
     ggctacctgt tcatcaagct ccagtgcgag ccggcaccac tgctgctggg ctttgtgctg     75780
     ggaccgatga tggaggagaa cttccgccgg acgctgttgc tgtcgcgcgg gacgttcact     75840
     gtgttcgtga ccggtccgct gtcgctcagc ctgctgattg ccgccgcgct gctggttggc     75900
     atcgttgccc tgccatcgat caaggccaag cgcgaggaag cgttccagga agagtagtgc     75960
     ccaagcgcga aggacctgcg ccggccttcg tgccggcgta tgcagcgtgt ttggcaagcc     76020
     gctgatgagc cgctgaacga cgcggggcga agcggtgctg gctatgcggc cagtggcacc     76080
     ctcagcgaga acaccgcgcc actgccgggc acgttgccgg cctcgatgtg gccaccatag     76140
     gcgcgtatga cctcttgtga aagagccagg cccagcccca cgccctccgc tgtcccggcc     76200
     cgcgcgccgg cgccccggta gaaccggtca aacagatagg gcagctcgct ttccagtatg     76260
     ccggggccct cgtccgccac gctgaggacg gcatccaact ggtcggtggc acagtcgact     76320
     atgatcttgc cgcccggcgg cgagaacttt agcgcgttgt ccagaagatt ggccagcacc     76380
     aggctgaccg gccctcgtgc gacttttccg tcaacgggcg atgttgcatt gacgacgagc     76440
     gttatctgcc gctcgcgggc actgggttcc acacggcgca gcgtctcctg gaccacggcg     76500
     ttgagcgcga cagtctgccc gctgggatgc tcctggcccg cgtcgagtct ggccagcatc     76560
     agcaggtcct ccaccagcag ggtcaggcgt cccacttcgt ccaggcacga ccgcaaggtg     76620
     tccacatact cctggctgtc gcgctggcgc cgcagtgtga cctcaatctc cgtacgaagc     76680
     cggtgacctg atgcggcaag tgaggcattt atcgattcga gagcaagctg acaagctcaa     76740
     tcgggtatta cgcggcctac gcgtactatg gcattgtggg gaacttccgg gcgttgcaga     76800
     aggtacatag agcggtggag cgttactggc gcaaaatgct gagtagccgg agtcgttcag     76860
     gcggcgtcac ctgggaggca ttccaggaaa tcaagaagcg gttcccatta atgcgaccaa     76920
     agctgcatct tccctatcgg gcgttgcaag ctatcgcggt gctgtgaatc aactgctgaa     76980
     gagcgtagtg cgatatgtgg tgttggctca aatgtggtct tgcggcgccc gtgccgcgat     77040
     cctgacggga tccggccggc cgaacgccac ataaaaagcc tgctacaagg accggagaaa     77100
     cgccatcaac gcgggatctt tggcccaccg cctaatcgcc tctcgatcgc tagcgatagt     77160
     aagccgcgcc agggcgttag ccttcatctc caaatcaatt tcggcgtaaa cgttggtcgt     77220
     atcgatagag acatgaccaa gccacgcccg tactgtgttg atatcgacgc cggatcgaag     77280
     caggtgggtc gctgttgaat gtctaatgct gtgcgggctg acgcgcttgg atgcgagcga     77340
     gggcatattg gctcgcgcct tgacagcgta gcgctctacg accgcgtgaa taccgaaacg     77400
     cgtcaggggt tgcccacagc gattgaggaa tacccgttcc tgcggtggtc gttggccagc     77460
     gaggttgcac aactcttgca cggtgtcggg ccatagcgga cactggcgct gtttcttatc     77520
     ttgccgagaa cgctcacgct gctggagatc gcatcgacgt tgccgatggt caggtgggct     77580
     gcctcgtccg cccgcacacc ggcattgtag agaaacagca gcagggcgta gtcacgtcga     77640
     ccttgagatg tacgtcgatc tgggcaagca aggagcgcat ccatttcagc cttgtcgaga     77700
     tagggcacca ccgctcttgt agtcttcttg tacgggatgc agcgcaactg ggtgcaccat     77760
     tggatatgtt ccgggctgtg ctcgccaacg aatcgagcca aagcatggat agcagccaga     77820
     cgctgattcc gcgtcgcgac gctgcatccg cgacggactt cgatatctga gaggaagtcc     77880
     cggacgatct cggccgacat atctgtcatt gccagccggt cgaccggttt gtgggcttga     77940
     cctgaaacga aagggatcag ttggcacagc gtgtcgcggt agctctgctg ggtgttgcga     78000
     gcgaggttcc atctgctcag gcgtgacggt caccggcttg ccaatcgtcc ctgccgccag     78060
     ttctcccttt tcactctgac gcatccaagc cccaaggcta cccttgggaa tgccgagaac     78120
     cttggccgtg accgcaatcg attggccggc cctcacttgg cgaaccgcct ccaatttgta     78180
     ttcctgtgtg tatttcgctc gcgtttgctt gcctgacatg tcttagctcc ttgctcgtat     78240
     ttgaacacag ggctaagaac tccactcttc gggggctaga tcaccgacat ccagcgtcat     78300
     ggtcttgtag cgggtgcgcc ctttggcccg gtagtccttc cagcggaagg tcacgccacg     78360
     ctcgtccagg gcgagcaggc gctggttgga gatcgccacg cggtgggtat agcgcgacag     78420
     gtaggccagt accgcctcgg gcccggcgaa ggtcgcgtgg catagaccac ccattcgcga     78480
     agcggcgcga tccactgcgc gaaggcggct ggatcggcga gcgtggcgta gtcaccgaag     78540
     aaccgcaatt gcccccgacc atgcgcggcc tggagggcct cgaggaagcg gcgtcggaac     78600
     aggcgggaga gcacgcgcac cggcaggaag aagccggggc ggcaagccac ccaccgttcg     78660
     ccgtccagtg acaggccgcc gccggggacg atgccgtgca cgtgcggatg atgcgtgagt     78720
     gccgatcccc aggtgtgcag caccagggtg gcgccaatct gcgcgccgag gtgcttcggg     78780
     tcggcggcga tggtgcgcag ggtgtcggcg gcgacatcaa acaacaggcc gtagatcacc     78840
     gccttgttgt accacgcgat ggcgctgatg ggcgcgggca gcgtgaacac gacgtggtag     78900
     tactccacgg gcagcagatc gtcactgcgc gcttcgagcc agcgacgtgc cgcgctggct     78960
     tggcacttgg ggcaatgccg gttgcggcag gtaatggaga gcaacccatt acctgccggc     79020
     atcgcgcctg cccgaagtgc cagtcgctcg cccgcgcgca atggctcgaa caccggcagg     79080
     ctgagctgct gcccgaggtc gagtatttcc atgtggtctt cacggtgccc gaccccatcg     79140
     cggcgctcgc ctatcaaaac aagaatctct atgacatcct gttccgcacc agcgccgaaa     79200
     ccctgcgcac gatcgccgcc gatccgaaac acctgggcgc cgagatcggc ggccagacct     79260
     catcgggtcc tgctcatagg ttcgtagccg cgatcgccaa ccaaaaaaac cctctcctgc     79320
     gggaaatccg cacgctacgt tctgtgggaa ccggaggcgg gtgactgcct ccggtcaccc     79380
     ggtgctcggg gtgcgattcc ccgggtctac ttaccaaatc ggccgcgcac ccaatgagag     79440
     gcgctggcac aagcttgcac agacttgccc gccaagcgga agcagccttg ccacatcggc     79500
     cgacccaatg gcaatgccgc tgccacccgc cggatggccg ttctggaaac ggcttgagcg     79560
     acgtcaagaa tttcctttct cgacaagcac ttagccgggc ctcctggtgg tttcccttag     79620
     gccctgcgaa attggcgcac atcctgcgtt ccacctgcgc atcgaagtga cgcaccaagc     79680
     aaggggcgaa cattagtaag gaggagacaa catggatagt cgtatcacga caatactcga     79740
     gcgctaccgc tcagaccgta cacggctgat cgacatactt tgggatgttc agcatgagta     79800
     tgggcacatt cccgatgcgg tactgccgca actgggggct gggttgaagc tgtccccgct     79860
     ggacattcgc gaaacggcgt cgttctacca ctttttcctt gacaagccgt cgggcaagta     79920
     tcggatttac ttgtgcaatt ccgtgattgc caagatcaac ggctatcagg cggtgcgtga     79980
     ggcgctcgaa cgcgagactg ggattcgctt cggcgaaacc gacccgaatg ggatgtttgg     80040
     cctgttcgac accccctgta tcggactcag cgatcaggaa ccggcgatgc tgatcgataa     80100
     ggtggtattc acccgcctgc gacccggaaa gatcacggac atcatcgcgc agttgaaaca     80160
     aggacgatcg ccggccgaga tcgcgaaccc ggccggtttg cccagtcagg acatcgccta     80220
     tgtcgatgcc atggtcgagt ccaatgtccg caccaagggg ccggtgttct tccgtggccg     80280
     gacggatttg agatctttgc tcgaccaatg cctgctgctc aagcccgaac aagtgattga     80340
     gaccatcgtc gactccaggc tgcgcggacg tggcggcgca gggttctcga ccgggctgaa     80400
     gtggcggctg tgtcgggatg ccgaaagcga gcagaagtat gtaatctgca acgccgacga     80460
     aggtgagccc ggcacgttca aggatagggt cctcctgaca cgcgctccca agaaggtttt     80520
     cgtcggaatg gttatcgccg cgtatgcgat cggctgccgc aagggtatcg tctatctgcg     80580
     gggggaatac ttctacctca aggattatct ggagcgacag cttcaggaac ttcgggagga     80640
     cgggttgctg gggcgcgcta tcggtggccg ggcgggcttt gatttcgata tccgtattca     80700
     gatgggggcc ggcgcttata tctgcggcga cgaatcggcg ctcatcgagt cctgcgaggg     80760
     gaaacggggc acgccacggg tgaaacctcc gttcccggtg cagcaagggt atctgggcaa     80820
     gcccaccagc gtcaacaacg ttgagacctt tgccgccgtg tcgcggatca tggaggaagg     80880
     cgcggactgg ttccgggcga tgggaacgcc agactcggcc ggcacccggc tgctgagcgt     80940
     ggctggcgat tgcagcaagc ctggcatcta cgaggtggaa tggggggtca ccctcaacga     81000
     agtgctggcg atggtcggag cgcgggacgc gcgggccgtc cagatcagcg gtccttccgg     81060
     tgaatgcgtg tcggtggcaa aggacggtga gcgcaagctc gcgtacgaag atctttcgtg     81120
     caatggcgcc ttcaccattt tcaactgcaa gcgcgacctg ctggaaatcg tgcgtgacca     81180
     catgcagttc ttcgtcgaag agtcctgcgg catttgtgtg ccatgtcgcg ccggcaacgt     81240
     tgatctgcac cggaaggtcg aatgggtcat cgcgggcaag gcctgccaga aggatctgga     81300
     cgatatggtc agttggggag cgctggtgcg gaggaccagt cgatgtggcc ttggggccac     81360
     atcgcccaag cccatcctga cgacgctgga gaaattcccc gagatctatc agaacaagct     81420
     ggtgaggcac gagggcccgc tgctgccatc gttcgatctc gataccgcct tgggcgggta     81480
     tgagaaggcg ctgaaggatc tggaagaggt gacaagatga gcattcaaat tacgatcgac     81540
     ggcaagacgc tcacgaccga ggaaggacga acgctggtgg atgttgccgc agagaacggc     81600
     gtttacatcc cgacgctgtg ctacctcaag gacaagccct gcctcggcac ctgccgggtg     81660
     tgttcggtca aggtgaatgg caatgtcgcc gcggcatgta cggtgcgggt ctcgaagggc     81720
     ctgaatgtcg aggtcaacga ccccgaattg gtcgacatgc gcaaggcgct ggtcgaattc     81780
     ctgttcgcgg aaggcaacca caactgcccg agttgcgaga agagcggccg ttgccagttg     81840
     caggcggtcg gctacgaggt ggacatgatg gtctcgcgct ttccgtaccg gttcccggtc     81900
     cgcgtggtgg accacgcgtc cgaaaagatc tggctcgagc gggatcggtg catcttctgt     81960
     cagcgctgtg tcgagttcat ccgcgacaag gcaagcggcc ggaagatctt cagcatcagc     82020
     catcggggtc ccgagtcgcg catcgagatc gatgccgaac tggcgaacgc catgccgccg     82080
     gagcaagtca aagaggcggt tgcgatctgc ccggtgggca ccattctcga gaaacgggtc     82140
     ggttatgacg atcccatcgg acgacgcaag tacgaaatcc agtcggtgcg cgcacgcgcg     82200
     ctggaaggag aagacaaatg agagcccccc acaaagacga gattgcgtcg cacgaattgc     82260
     ctgcgacgcc gatggatccg gcgctggccg cgaaccgtga aggcaagatc aaggtggcca     82320
     cgatcggtct gtgcggctgc tgggggtgta ccttgtcctt tctcgacatg gacgagcggc     82380
     tcctgccgct gttggagaaa gtcaccctcc tccgctcgtc gctgaccgat atcaaacgaa     82440
     ttccggagcg ctgtgcgatc ggcttcgtgg aaggtggcgt ctcgagcgag gagaacatcg     82500
     aaacgctgga gcactttcgc gagaactgcg acatcctgat ttcggtcggg gcgtgcgcgg     82560
     tgtggggcgg tgtgccggcg atgcgcaacg tcttcgagct gaaagattgt ctggcagagg     82620
     cttatgtcaa ctcggcgact gccgtcccgg gcgccaaggc cgtcgttcca ttccatcccg     82680
     atatcccgag gatcaccacc aaggtctacc cttgtcatga ggtggtcaag atggattatt     82740
     tcattccggg ttgtcccccg gatggagatg ccatcttcaa ggtgctggac gatctggtga     82800
     atggacggcc attcgatttg ccgagctcga tcaatcgcta cgattgatta acggagggtt     82860
     tgttatgagc agaaaactgg ttatcgaccc ggtgacccgc atcgagggtc acggcaaggt     82920
     ggtggtgcac ctggatgacg acaacaaggt cgtcgacgca aagctgcacg tcgtggagtt     82980
     ccggggcttt gaaaagttcg ttcagggcca tcccttctgg gaggcgccga tgttcctgca     83040
     gcgcatctgc ggcatctgtt tcgtcagtca ccatctgtgc ggggccaagg cgctggatga     83100
     catggtcggc gtcggcttga agtccggcat ccatgtcacc ccgacggcgg agaaaatgcg     83160
     ccggctcggc cactacgcgc agatgctcca gtcccatacg accgcctatt tctacctgat     83220
     cgtgccggag atgctgtttg gcatggacgc gccgcccgca cagcgcaacg tgctcggcct     83280
     gatcgaggcc aatcccgact tggtgaagcg cgtcgtgatg ttgcgcaaat ggggacagga     83340
     agtcatcaag gcggtgttcg gcaagaagat gcacggcatc aattcggtgc cgggaggcgt     83400
     caacaacaac ctgagcatcg ccgagcgcga ccgtttcctg aacggggagg agggccttct     83460
     gtcggtggat caggtcatcg attacgcgca ggatggcctg cgcctgttct acgacttcca     83520
     tcagaaacac cgggcgcagg tcgatagttt cgcggacgtg cccgcgctca gcatgtgcct     83580
     ggtcggcgac gacgacaacg tggactacta ccacggcagg ctgaggatca tcgacgacga     83640
     caagcacatc gtccgtgaat tcgactatca cgactatctg gatcatttct ccgaagcggt     83700
     ggaggaatgg agctacatga agttccccta cctcaaggag cttgggagag agcagggatc     83760
     ggtgcgcgtg gggccgcttg gccgcatgaa cgtgacgaag tcgctcccga caccgctcgc     83820
     gcaggaggcg ctggaacggt tccacgccta cacgaagggg cggacgaaca acatgacgct     83880
     gcatactaac tgggcacggg ccatcgagat cctccacgcc gcggaggtgg tcaaagaact     83940
     gctgcatgac ccggacctgc agaaggatca gctggtgttg acaccgcccc ccaatgcgtg     84000
     gacaggtgaa ggcgtcggcg tggtcgaagc gccacgcggt accttgcttc accattatcg     84060
     tgccgatgag cgcggcaata tcacgttcgc caacctggtc gtcgccacca cccagaacaa     84120
     ccaggtcatg aatcgcacgg tgcgcagcgt cgccgaggac tacctgggcg gacatggcga     84180
     aatcaccgag ggcatgatga atgccatcga ggtgggtatt cgcgcctacg atccatgcct     84240
     gagctgcgcg acacacgccc tggggcagat gccgctggtg gtctcggtct ttgacgcggc     84300
     ggggcgcctg atcgatgaac gcgcccgctg agtttcccta tgtgaccctt gccgatttcg     84360
     atgatccgtc gacgctgatc tacggaatcg gcaacgtggg tcggcaggac gacggattgg     84420
     ggtgggcttt catcgaccga ctggaagcgg agtccctctg ctccggggcg gaggttcagc     84480
     ggcattatca gcttcacctc gaggatgccg acctgatcag ccgcaagaga aaggtgttgt     84540
     tcatcgatgc cacgaaagat gcgtcggtgg cgtcattcag cctggagcgc gcggaaccac     84600
     ggatggactt cagctttacg tcgcacgcga tctcgattcc gtcgatcatg gcgacctgcc     84660
     aaaggtgctt tcagtgcttg ccggaagtct atgtgctggc gatccggggc tacgagtggg     84720
     agctccgcat ggggctgaca ccgcaggcac ggcataacct ggacgatgcg atcgcccatt     84780
     tctcgatgcg ggccgagcgt caaacctcgt gaaatcagtt agaaggagaa cgcgatgaaa     84840
     gagcaggaaa tcgacaggat cgcaacgatg atctacgagg cgcctttggg cgagtatatc     84900
     ggccgggatg gcgctgccat tcttgccgaa cacgccgcgg aagcacgcct cctcaagggc     84960
     gatgagtttc tctaccggag aggagatgtc acaagcagct tttatatcgt gaccgatggg     85020
     cgtttggcgc tggtcaggga aaaaaccaat gagcgcaccg cgcccatcgt gcatgtgctg     85080
     gaaaaggggg acctggttgg cgagctgggt tttatcgatc agacgccgca ttccttatcg     85140
     gttcgtgctc tgggcgacgc cgccgtgctc agcttcagcg cggaaagcat caaaccgctg     85200
     atcaccgagc atccggaact cattttcaac ttcatgcgcg cggtgatcaa gcgcgttcac     85260
     catgtcgtgg tgactgtcgg ggagcacgag agggagttgc aagagtacat ctcgacgggg     85320
     gggaggggac ggggttagtc actctccgcg tccagctgaa atgcaaaaaa gcatatccct     85380
     cgagcgccag cgacgtgcgt cccgtcgagt ggtacctcag cgcgtgaccg acatggtagg     85440
     agccgatcat gcatgagatg tcgctggccg tgggtgtgct gcagatcgtc gaggacgtgg     85500
     cgcagcgcga cggtttttcc cgcgtaacgg cagtacggct ggagatcggc cggctgtcca     85560
     gtatcgagcc ggaagcgctg cgcttctgct tcgaggaggt agtgcgcggc agtgtggctg     85620
     acggcgcgcg gctggagatc gtggacaccc ccggtgccgg ctggtgcctg cactgcagcg     85680
     agacggtggc gatcggagcg ctgtacgatc cctgcccgca gtgcggcggc taccaggtgc     85740
     agcccactgg cggcacggaa atgcgcgtca tggatctgga agtggcgtga cggaaagcgg     85800
     aagtcacgcg gaatagaaga cgaggagaca ggatcatgtg caccaactgt ggctgcgccg     85860
     ccggcgaaac ccgcatcgaa ggccaggagc tggagcatgt cgacgagcat gcgcatgccg     85920
     acggcaccgt ccatggccac gccccccatc atcacggcga gcacgatcac gaccacggcc     85980
     ctgcctaccg tgccgtgcgc ggtactgacc atctgcatta cggtcacgga cccgctggtg     86040
     cccatgcccc aggcatgagc caggcgcgca tggtgaagat cgagcaggac atcctgggca     86100
     agaacaacgc ctacgcggcg cagaaccgcc gctggttcga cgagcacggc gtgttcgcgc     86160
     tgaacttcgt ctcgagcccc ggctccggga agaccaccct gctggtgcgc accatcgagg     86220
     cgctgaagtc cacctccagg ctggccgtca tcgaaggcga ccagcagact tccttcgatg     86280
     ccgagcgcat ccgcgccacc ggcgtgcagg cgctgcagat caacaccggc aagggctgcc     86340
     acctggatgc ccacatggtg ggccacgcgc tggagaaact gcggccggag gacgagagcg     86400
     tgctgctgat cgagaacgtg ggcaacctgg tctgcccttc ggccttcgac ctgggcgaag     86460
     cccacaaggt ggtgatcctt tcggtcaccg aaggggagga caagcccctg aaatatcctg     86520
     acatgttccg cgccgccagc ctgatgctgc tcaacaagtg cgacctgctg ccgcacctgt     86580
     ccttcgacgt ggagagggcc atcgagtatg cgaagcgggt gaatccggac ctgcacgtga     86640
     tccggacctc gtccgccacc ggtgaaggct tcgacgcatg gctgacgtgg attgccgatg     86700
     gcctggccgg ccaggccgcc aggcgcagcc agagcatgga gctactgcgc agccgcatcg     86760
     ccgggctgga agcgcaactg gcggcgctca aggtgtagcg gccatgctga tgccgcgccg     86820
     tcctcgcaat ccgcgcaccg tccgcatccg catccgcgtg cgcggcgtcg tgcagggcgt     86880
     gggcttccgg cccttcgtct atcgcctggc gcgggagctg ggcctcgccg gctgggtgcg     86940
     caacgacggc gccggcgtgg acatcgaggc ccaagggagc gccgcggccc tcgtcgagct     87000
     gcgcgagcgc ctgcgccgcg acgcgccgcc cctggcgcgg gtggatgaga tcggtgagga     87060
     acgctgtgcg gcacaggttg acgccgacgg ctttgccatc ctcgagagca gccgttccga     87120
     tgccgccgtg cacaccgcca tcggccacga cacggccgta tgccccgact gcctggcgga     87180
     gctgttcgac cccgcgaacc ggcgctaccg ctacgccttc atcaactgca cccagtgcgg     87240
     cccgcgctac accctgacgt gggcgctgcc ctacgaccgc gccaccacca gcatggcgcc     87300
     gttcccccag tgccggccct gtctcgacga gtataacgca cccgagcatc gccgcttcca     87360
     cgccgagccc aacgcctgtc cggactgtgg ccccagcctg gcgctgctca atgcccaggg     87420
     catgccggtc gaggacgttg atccgatcgc cgagacggtg gcgcgcctgc agcggggcga     87480
     gatcgtcgcc atcaagggcc ttgggggctt ccatctcgcc tgtgacgcgc acaatgccga     87540
     cgcggtggcg cggctgcgca gccgcaagca gcgcgaggag aagcccttcg ccgtcatggt     87600
     cgcgaacctg gcgacggcgg cgcagtgggg cgacatcggc agcggtgaag cggccctgct     87660
     cacggcgtcg gagcggccca tcgttctgct gcgcaagcgc agcggcgtcg atgggcggtt     87720
     cgcgggcgtg gcgccgggac tggtctggct gggcgtcatg ctgccgtaca cgccgctcca     87780
     gtatctgctg ttccacgagg ccgctggccg ccccgagggc ctcggctggc tcgcccagcc     87840
     gcagtcgctg gtgctggtga tgaccagcgc caaccccggc ggcgagccct tggtcaccgg     87900
     caacgacgag gcggcgcagc ggctcactgg catcgccgac gctttcctgc tccacgatcg     87960
     cgagatcctg gtgcgttgtg acgattcggt ggtgaggggc gacggcgaac cagcgcctca     88020
     cgtccagttc attcgccgcg cgcggggtta cacgccgcgg gcgatcaagc tggcgcgcag     88080
     cggcccctcg gtgctggcgc tgggcggctc cttcaagaac acggtgtgcc tgacgcgcgg     88140
     cgacgaggcc ttcgtctctc agcatgtggg cgatctcggc aacgctgcca cctgcgaggc     88200
     cctgatcgag gcggtggccc atctgcagcg ggtgctggag atccggccgc agctcgtcgc     88260
     ccacgatctg catccggact tcttcagcac acgccacgca gcggagctgg cggcgcaatg     88320
     gggggtgcct gccgtcgccg tgcagcacca tcatgcccat attgcggcgg tgctggccga     88380
     gcacggctcg gacgaacccg ccatcggcct ggcgctggac ggcgtcggcc tgggcgacga     88440
     cgggcaggcg tggggtggcg aactgctgct ggtggacggc ggcgcctgta agcgcctcgg     88500
     tcacttgcgc gagctgccgc tacctggcgg cgatcgcgcc gcgcgggagc cctggcgcat     88560
     ggccgctgcg gcgctgcatg cgatgggccg cggcgaggag atcgaggggc gcttcccgcg     88620
     gcagccgggg gcgccgatgg tgaaccgcat gctggcccag cggcttaacg cgcccctctc     88680
     ctccagcatg ggccgctggt tcgacgccgc cgccggcctg ctcggcacac gggaaaccat     88740
     ggcctacgag gggcaggcgg cgatgctgct ggaagggttg gccgagagct ggggcgagca     88800
     accgtcgccg ggccgcccca agacggttgc tcactccctc gggggggtgc cgcgcagcgg     88860
     cgggggtaca tacaaggcgc tggcgctgcc cgatgcctgg cgcatcgatg cgggcaacac     88920
     cctggatctg ctgccgctgc tcgaggcgct gtccgccgaa acgaatgccg cgcgcggcgc     88980
     ggcacagttc cacgccaccc tggtggcggc gctggaagcc tggaccgtcg cgaccgtcca     89040
     ggtcaccggc gtgcgcacgg tcgtcttcgg cggcggctgc ttcctcaacc acatcctcgc     89100
     ccgcaacctg tgccggcgcc tggcggcgcg gggactgacc gtgctgacag cgcgccagct     89160
     gccgcccaat gacggaggca ttgccctcgg tcaggtctgg gtggcgctgc agcgggcgcc     89220
     caactgacga gagggtagaa catgtgcctg gccatacctg cacgcatcgc gaaaaaattt     89280
     gacaacgaca tggccctcat cgacctgggc ggcgtgggga gtggccaaaa acggggggca     89340
     aatccgtcag gaaaggggtc tattgtgtac tgagactacc ggagaccgcc atgcgcatct     89400
     cgatccaagc ctgtattgag cgggcgggcg aacagccctc taaggtgatt gaagttgcgg     89460
     tgatcgagcg caatgccgat gtcgctccgg cctcaggact gggcctgttc attcgcgagt     89520
     cacaagagat cctgcgacag cttcagactg tggtcttgac cgagcaggtg gaccagttca     89580
     tccggattac cggtcgctgt caactgtgcg gaggcaggct tgtcatcaag gacacaaaat     89640
     ccttggtcta tcgcaccgct tttggcaagg cgaggctgcg aagcccgcgc ttttactctt     89700
     actgcagcgc atgcggttac tgctcaagta acaagggcac gctttccccg ctggcacagg     89760
     cgttaccaga acgcgtacat ccccagtgga cctggctgca gtgccgatat gcaagcgtga     89820
     tgtcttatcg tttggcacag atctttctac gcgacgcgtt tgccggcgga cgggaactcc     89880
     catgctcgag cgttaagttg aatgtaggcc gggtcgggca gcggctggag caagaggcgc     89940
     aacgtgcaac gatggtgatg tcggctgtga ccgcgccacc gcgaagctcg ccattaaccg     90000
     ggacgccgat tggtctgcag atcgatgcag gttatatcaa gacgccgcgg cagcaggatg     90060
     gtaagcgatg gactcccgtg gtcgcctcca agctgatttg gcccaagact cctcgtaccc     90120
     atgcgcatgc ctacgcagta gggcatgacc ctagccaagg gctgcgtcag caggcgttct     90180
     tacagtctgt tggcatcggg ccccaggccc cggtcacagt catcagtgat ggcggcgatg     90240
     atattagttt cgcgtgcaag ttgccatcgg caacggcccg cgtgctggac tggtatcaca     90300
     ttggcatgca caaagcgaaa tggctgttgt ggcacggtga gtcgaagcgg tgcttggaga     90360
     ggctggagtc gctgcgacgg gacacaggtt gggttggcgc tcgcaatcca ctaggacgcg     90420
     tgattcgtta ccttcgctgt tgctctcgct atctcgcaaa ctatcagcag cggcgggctc     90480
     aggggctgcc gatttcaagc gcgggagcag aatcggtggt cgactatgtc attggccagc     90540
     gcatgaaaag gaacgggcac atgcgatgga cgattctttg agcacgcgtt cacgcagccg     90600
     gttcttcgag tatgcatcag tgccacgcag acctcggagt gccatgagga ggttctcgaa     90660
     tcgtcctcgc cgttgagaac ggcacatcga acctgcagta gtccattggc tccacacatg     90720
     ccatatgcgg ttgtggactg tacggtataa accgcgcccc cgcgtttggc cactcccatt     90780
     tcgatattgg cggaaactgt gaccgccatt ggcggaaata tcgatctgca acagaaagtt     90840
     ccggttcctg aaaggtaaaa atcccacact ctggggaagt gtggggttcg gggaggtgaa     90900
     tcaggttggg ggaggtctct gcgctcggac ttgcagccct tagagggcgg cgcggtcgga     90960
     tgcaatgtag tacctggcgc cgtccgtata agtgtcgaat ttgccgcttt ttgcgccgtc     91020
     agtgtaaaca tcgtacttac cagaccgcgc gccgtcagtg taagtatcga atttgccact     91080
     cttggcaaac accggagcgg ccgccagggt ggcagcgagt gtggtgacag cgactagggc     91140
     ccggcgattg gtattcatgg cttacctctt tctttaaact ggtgaatgcc attccctttg     91200
     gtttagtgct tgttgcactg cggcattcga tgagcgccat attagggatt tcccttgtgg     91260
     cggtaaaccc ttacgctcgc aacgatcggt ttcaaaatcc acaatagtct gccctgaacc     91320
     gaaaaaattc gggcagaacg cgaccgacat gtgtgttggg gccgagccct agcaatttgc     91380
     cttcgctatc ctttagatcg atcaacaaca cgtcgaatcg accgcaccat cacatgtcgt     91440
     tgtccatccg agcgcgcccg gcccgaagga cgaagcgggc gcgcggcacg cgcccgagcc     91500
     agcgcccagg tcctacgtca gttgttgctg caccacccga tccgatgccg ctcctgcgtg     91560
     gcctcatgcc gcgcatcctc ctcgctgtgc agataaccgc tcgtcgttga cagcgagctg     91620
     tgcccgaagt tgtcgcgcac aaaacgcagg tcgacctgct ggtcggtcat gtgcgagccg     91680
     gcggtgtggc gcagccagtg cgccgaggcg ctggccagca ccgctgcttg tggttcccat     91740
     tcgggcccgc gcgcccgcag gcgcgcggcc gcctggccga acacctcttt gagaatcagg     91800
     tgcagcgcgc cgcgcgacag cgctttctcg ctgcctgctt ttccaattac cggcagcacc     91860
     agtggacgcg tctccccgaa ctgcggggta ggcggcaacg cgtaggcgcg gcggtagcgc     91920
     gccagttcgg caatcagctc atcggtcgcc ggcaccagcc gaatcttgtt gcctttgccg     91980
     ttcacctcca gccaccagcg ctcggttccg tgggaatcgc gtcggcagaa gaacgcgccc     92040
     atggtggtgg ccgtcagttc ggaggcacgc aggccgccca gatagagcac ggttaatacc     92100
     cagcggcagc gcgccgcgtg caggcgttcc cgcgccgtct cggtcggcat tgccgcgacg     92160
     gcgtccttga ccgtatccca caggtcgtgg ctcagatagc gggtgatgcg cgcctgagtg     92220
     ggcgcgcggc ggcggcgggc gagggcgagc gggttgccgc ccaggtaacc cgcctcggtc     92280
     agccaggcga acagcgcgtt caggatcacc agcgcctggc gcacgctgcc gggtgacagt     92340
     ggcccggcaa acgggcgcca gtccggatgg ttgcgtgcga gtttcttgct accggccagc     92400
     acccagcgcg cggccggttg cggatcggca aggaagcgct cgtagacgag caggtcttca     92460
     tgggtcagcg aggacaaggg tttgcccaac tggagcacgg cccacaggat tagccgttca     92520
     acctcgcggc gataggtggc gaccgtcgcc acgctgtcgg catagcgcgc gagccaggcg     92580
     gtcacggcgg ctaggtcgtc gcccgcggcg attcgcgtgc cggtggtggg cgcgcggttg     92640
     cggccgtcgc gcccggacag cgccgacggc agccgcaact gctccagcgg cgtgggcagg     92700
     gcggcgagag ggcgggacgc aggcgggtag ggtggatgtg cgggtgattc caaaatcagg     92760
     cgttagtttg cacaattttg tatccgagac gtggccgtga aatcgacgca gcccgggcgt     92820
     gcgagaacaa atttacttca cgaaattctg caccattttg ttcccccggc gaacattcga     92880
     agcaattttg tatcttcgcc aacgtttgtt ccattctcgt cgtgcgattt ttcccgaagg     92940
     tgccctaagg tttataaccg tcgcctctta ggcgatcggc ccattttgga gcgtcgcatg     93000
     gaagacggca ttgacgacaa ttccggctct tttgaaaaat gagtgggtta tgcggcatgc     93060
     gggttgatcg cggagaagtc gagctttccg gcgatcagga agatcacggt gcgcatggtt     93120
     ttgaagctca cataaccgcg ggccttgcgc ttggcggctt ggaacaggcc gttgagcgcc     93180
     tccaggaagc cattggtctg gcgcgtctgg gtccatgcaa cgataccgtc gaaatgcttg     93240
     cggatcatgc gcgcgacctc cttcattggc tcgaccttgg atcgcatgac gttcgtgcac     93300
     cactgctcga gcattgcgga aacaacgttg atctgcttgc gctcaaggat ttcgcgcaac     93360
     tgctcgcgat acagccaggc acgggcagtg cgtttggtcg tgacgttggc gatcaacgcg     93420
     tcgagatcgg cacgctgcgc ggctggcaac ccgtcgcgat ccttgagcag cgtccagcgc     93480
     aggcctttga ggcttggatc ggtcttctgt tcgatacgcc gggtcttgtc cacggctgca     93540
     gaagcgtgag ccacgacatg gaacttgtcg aaggtgatgc gcgcgttggg caaatgctcg     93600
     ctgacgccct tgatgaacgc cggcgacatg tcgatactga ccaccccgat ctgctcaggc     93660
     gcagcgttgt tctcgcgcag atgtgcagcg aacttgccaa ccgtggcagc atccttgcct     93720
     tcggtcacaa acacgacctt acgcgcgtcg gcatcagcga caagcgtcag gtagttgtga     93780
     ccgcgcctgt aggacgtttc gtcaacggcg gcagcggtca cgccggccag atcgagttcg     93840
     gccaccgcga ggtcgacata gcgctcgcag atagcgtaca cgcgatgcca cgactcaccc     93900
     accgttctgg ctacagcaga aaacggcatc tgctgcgcaa gcgccaccac catggcttca     93960
     aacagcaacg tgaagccaga gagcttgcca gcccagtccg gctcgaccaa caccacgcgg     94020
     ccgtcgggaa gcttcacgcg tggcgtgcgg acttccagat agcagtcgtg ctcgaagaag     94080
     ttcaggtgcc gatagcgttt ggtcaccgtg tcgtgaaccg ggtgcccacc ggcgacctcc     94140
     gggtgggaaa agcggctgcc ggcgacaaag tcaatctgga tcgtcaacgt cttggtttgc     94200
     gcgttgaagt cgacttcccg gacgaaccac ggatcgctta tgccaagggc tgcttcaaac     94260
     agtttgctat gcatcgctct tgttgctctt tacctgaaac ccgccacgat accacccact     94320
     tgaaattcaa aagaggcaca attcctatta ctcccgccgg atgatagacg ggcgaaccgt     94380
     cgacactgcc cactgggcca gccccgacga gggagcgctt actggtgacc gacgcgtcct     94440
     gtaccttgcg agaaagcagg cggtttcgct gtatcttttc ggtgcctcgg gcgaaagcat     94500
     caggcggctg acgtcaattg gcgcaagaca ggcctatcgt ctcatccggg agcgctgcct     94560
     tgagacgcat cccgacgggc gtccttatgg ctggcgcgga cttgtgccat ggctccgagt     94620
     caagccatac cgtcgtagca ggaaggtcca tgtcgacccg ttcggccgcg gcgctgcggg     94680
     cgcgatgcag gcgctgctgg actgccagcc ggcgcttcgt caggcatttg aggcgcgtat     94740
     cctcacgagc gcctcagcca agcggctagt cgaaactaaa cagtcgagaa ggcgtcattg     94800
     cgcgtggttt ctggaccaat tgcgtagctt cgggtacgaa gcgcgaaacg aatggccgtt     94860
     caacacatcg agccttggct actcttcgat ctgtcggtat atcgacaagg tgctgtcggc     94920
     ccacccaagg gcgctggccg cggcgagtgg cgggccgaat ttggctttga agctgaggtc     94980
     cggtgacgga accgggcggc cggtgctgag gttcatgcaa cgcgtcgaga tggacgcgca     95040
     caagctagac ggacgtttct gcgtgtcgct tcccctcatg gggggcggtt tcaaggagaa     95100
     gatcgttcat cgtctctggg tcgttgtgat cctggaggtc gtttcgcgcg cggtgctagg     95160
     gtactacttc agcgtgagac gggaagtatc gaaagatgac gtcatgcgcg cgctgaagcg     95220
     ggcattgggc agatggtgcc tgcgcccggt cagtttttgc gatacgccgt atctgcctga     95280
     agccgggctt ctttccgctt tgggtagcga tttcgtcggg ctatgctggg acgagaccag     95340
     cgtagatggt gcgcttgccg agacttgtca gcacgtgcgg gatgcgctgc gcgacagcgt     95400
     cggctccacg ctactggacc cgaagacctc gttctcgaaa cgtcgaagca aggatgaccg     95460
     cccgttcatc gagtcgtttt tccgcaatct ggccggacag ggatttcagc gtctttccaa     95520
     caccaccggc gccaatttcc aggaccgcaa gggaagacag ccggaagagg tcgccctggc     95580
     gagtcgattc cagtacgaat atgcggaaga gttgctggac gtgctcattg ccaactacaa     95640
     cgcgacaccg cacagcggga ttggtaaccg cacgccgctc gcgtatgcga agttcttgta     95700
     ccaccattcc cagcagagct tccggcgagc cgaccccgct atcgtggaca cgctattcag     95760
     catccgcaag cgctgcatcg tgcgcggggg cgctaaaagc gggcgtgccc cgttcgttga     95820
     gttccattac ggccgttata ccaacgacgt gctgcataac cggcacgacc ttgtcggatc     95880
     cgagatctgg gtggtctgcc acaaggagga tgactgccgg gtggcgcttg cctccacgct     95940
     ggacggtatg tcactcggcg ttttgcgggc agcaccgcct tggaacatgt cgccgcacag     96000
     cctgtcgcta cgtgctgcaa tttgccaggc gtgtactcac ggaaagtttg cgattccggc     96060
     aggcgtcgac gccatcgatg tcttcatgcg ctacgtggag agtcaggcgc acaaccgctt     96120
     gccggtccat ccggcctacc tcgaggcacg gcgcatactg gcagccgcag ccgaatcatc     96180
     aatcgggcct tccatgctgg atgcagcaat ggctcggacc aaggcaggca gcagttcttc     96240
     gaacggtagc aagggggccg cgccggagcc gacggcaaga cgcgcgcagt ctggcgcctc     96300
     ggacccgctg aagccttctg cgggttccac gctgcctccg cgtcgaatgg cgcagtcgag     96360
     gtaagccatg tccttctcac tacccgagcg catcgatccg cggcactgca tcgtgacgaa     96420
     gcagtacgcg gtgtatacac cgcccatgca cgaaatgatc gagcaaatcg gcgaatggat     96480
     cgaccagcag cgccccggcg gctatatcta tggcgcgtcc cgcctaggca agtcccgctg     96540
     tgtgcagtgg tacgttgcaa acgaattgca ggagcgcttc aaggccgtca tgcccctggt     96600
     ggtgtggaat cgccgccccg acagtcagag tagtgaagcg ggattctggc accagctcct     96660
     actcgcctcg cgcttcgaat tcgccaaccc ggcaaagcca ccgaagaaag ccgaaggcat     96720
     atacctgtgc aagcaacgct tcatcgccat tgcgaacaac gcgcaacgga actacgtggt     96780
     gctgcttatc gatgaagcgc aggatctgac gttgcgggag tggaaatggc tggtcggcct     96840
     gcaaaatgag ctcgattacg agggctattt actcagcgta ttttcagtcg gctcacacca     96900
     gttgaactat cgccacgaat atatggccat cacgggcaac gctcacgtcg ccgcgcgctt     96960
     tatggcagcg catgcgcgct tccacggcct gcgctcgccc gaggagatcg ggtacgtgct     97020
     caacggctac gatagcgact ccgagtggcc gccaagcagc ggcgttccgt acctggagca     97080
     cttcgcaccg gcggattatg cggcagggcg ccggctcgcc caatgcgcgg cgcagctgtg     97140
     gaaagcgctg atggagcttt cgcccgaatc tgcgcgccgg catttcgagt ttccaatgca     97200
     gcatgtcgcg aaagcgaccg aggcgatact cttccaactg gcgcggggcg aagactgggc     97260
     cgacgtgacc tcctacgaga gctggttgcg agaactcgcc aaagcgaact tcccggacca     97320
     catgaggatc atctcgacgg gtggttgaca tggcggccta cccatcggtg aactggtggc     97380
     cgggaaacct ccgtccgtac gagtcgaggc tgtcgttcgt cgcccgcttc tgcgcactga     97440
     atggcatcaa cgtccgaaaa tgcgcggagt ttttgagggt ggagcccgat ggctgcacgc     97500
     cgcttccgat cgacgaaatc aagcgcctgg cgtccgtgct cggtgaggcc gcgccgcttg     97560
     tcgaagacgt tttctcgcct tccatacggt tcatcgatgt cggccgttat ggcccgcctc     97620
     ccgatagtcg cgagcgacgt gccatccgct attgcgagac ctgtatgcag cacggctacc     97680
     acagctacct gcatcagctt gggtggcttt cgcggtgccc atttcacctg agcgagctga     97740
     aaacgacctg ggcgcagaag cacaccgcca gcttcgtgtc gcagcgtgtg ggcgcgttgg     97800
     agttcgtgat gcggcaacgc tgcaggacat ggccgcacgg cattgatgcc ggctttcccg     97860
     cccgagagca ggggcgtgtt gcgtcgctcg ccggctgggt cgcacgggcg agcgtcgctg     97920
     ccgcgcgcat gtcgctcggc gagatctggt cgtcgggcaa cgatggcatg ccgggggctg     97980
     tctccctcga ccaagcgttc gctcagctgc gcacgcttga gcccccgccc gaggacatcg     98040
     agcagctcct tatcgaagcc ggtgatcggt ggactctgga aagccacgtg tttgcgcggc     98100
     aagcgaaaat ccaactcggc cacctcaggt tgtgccacct cagctttgcc gacgttcttc     98160
     acttctatat acgcatcaac gccgcttcgg cgaatccgtc ttcgtttgtc acgcgcctga     98220
     atgccatcca ggaccggcag gctcgccatg gcacctgtcg ctgtcggtgg aggctgacca     98280
     aggagggacg gctctcgcgc tgggtcagcg tgcgtccaga ggaggggccc cgctggggcc     98340
     tgatctgtcc atacgatatc gcgctcaacg aacttcaact cggctggggc cgttcggacc     98400
     tggcgctctc caatcggccg gcggagcagg aacggcggcg cttttgcagc gtttctcacg     98460
     cgatgcgcga cttgggcctc atccggtata cgcgggatgc agcggtagcg ccggcgggct     98520
     atctatatgc cgatcaggac gtctggacct gctgcgagtg ggttcgggag tcgccgctaa     98580
     ccgcagtgct cgatatggcg gtcgcgtggg aaaccgagct gacgttcgac gcgttgacca     98640
     cttggctaga tgacatcgat cggggtgtcg ctccgcttga gcgcgacgat tccaagtctt     98700
     gcgtccgcct gcgcgaaacc gacgatggcc tcttgctgat caagtggacg agggcagaag     98760
     cgaatgtgcg tcgggggcta tcccggatct gaacacgacg taccgtgagc aacgtgaagc     98820
     cgttggcttg cggcgcgcca gagtttcggc ccagggggct cggaacaaaa ttgtgcagac     98880
     aacggtaaca aaattgtgca aaccaacgcg agcctcgaga gtcacactca atctcaatat     98940
     tataaacata agcgcagtta tgtctaaagt tatacggcaa acgttagcta ttaaacgtaa     99000
     tacgtagtaa tatatatagt cacataactc gctttttcgc gatgccggct gtcgacctcg     99060
     atctgaccga cgccacgctg caggctgatt tggccgagct gcgcgggcgc tttcccgaga     99120
     cccgcgcgct gtatcgcgag gtctgcggcc tgctgttctt ccgctatggc gtcacgccca     99180
     ccgccaacaa gctctacagc ctggtgcgca ggggcagcat gggcacgccc gccgaggtgc     99240
     tgcaggcgtt ctggcaggaa ttgcgcgggc gcacgcgcgt caccatcgac catcccgact     99300
     tgccggaggc gttgaaggac atcgcggccg gggcggtcca gaccatctgg caggcggcca     99360
     acgaggccgc caccggcgag ctggccacgc tgcgcgccga ggcccgccat gcggccagcg     99420
     ccgccgaggc cgagcgtgat gccgcgcgga ccgagaccgc ggcggcccgg gaggaggtgg     99480
     ccgcagtctc ggcgcagctg gccgaggcgc gcgacgcgca cgctgccgtg caggcggagc     99540
     tggccgcgca gcggcaggcg cacgcggcga ctcaggcccg gttggaagcg gggcgggagg     99600
     aactggacgc cgccgggcgg cagctggcgg agctgcgcac ccaattctcg accgagctcg     99660
     agcgcgcccg cgaggcggtg gccctcgcgc aagaacgggc cgaggccagc gagcggcgga     99720
     gcctgcgtga gctggacgcg gagcgtaccg cgcgccagca gagcgagcgc acggccgaag     99780
     cgttgcgcgg cgaactggtg gcggcgcgca gcgaggcccg cgacgcggcc gtggcgcagg     99840
     ccgaagtccg cgcccggctc gaagcccagg ccgcggcgct cgccgatcgg ctcgccagcg     99900
     ccgagcaggc gcagcgcaaa gtggcgcacg acctggacgc ggtgcaggcg gcgttggccg     99960
     cagcgcagcg ccgggccgaa cgggccgagg ccgaagcggc gctggcgcgc cagctgctgg    100020
     cagaattgcg ggtgacgcca cccgggcggg gggacggtgg tggcgggcgg cggcgcaagg    100080
     ccggcagccc ggcgccgacc gaacaggcgg cgccacgcga aaaactggac gacaagcagg    100140
     acggacagca agaaaatgac aggcagggcg tgccgacggc cgcttccaac ccggatgacg    100200
     gcagcgacag cagtgacgac agcaacgaca gcgccaatga cagaaatcaa tgagcgggcc    100260
     gcggcgatcc gctggatcca ggcggagatg gccgactacg ggctgaccat ggaggagctg    100320
     gcagcggcgg ggtgcttcga tccgccgccc cctccgccgc cgccgctacc cgcaccagcg    100380
     ccaccgccag tggtgtgcta ccgcaacgcc gcggggcaga cttgggacgg gcagggcgac    100440
     atgcccgact ggctgcagcg ggcggccaat gcggggcagt cggtggagtt ttaccgggcc    100500
     ggataggact taatattatc cccgcttcaa cagcagaccg gtctggggcc gtactccttt    100560
     tgatagcgga ttccccttat cttggcttgg cccaaactac tcgcagcttc ttggtcgtat    100620
     cggacaaata tcacaatctc ttagcaatat tgtgacagaa tcccactgtc gctgacagtg    100680
     acgtccgtgc taattatttg gagatcgatg aatggtagtc gctggtgtct ttttgaaggc    100740
     aaacctcgct cgaatcgttg cgctcaccgg tactcgagag tcgcatacat tagttggcag    100800
     tcgattcaat aaactcgaac tcatcaaaaa tccgtcacaa gatgatgtcg aggtcttcgt    100860
     gcaggcgctc agagcttttt gtgctgagca ttaaatagac aaaattgtgg taaatcgtag    100920
     ggcaacttcc gggcaaggcg caggtggggc aggaacattt ctgattgagg gcgttctgct    100980
     tgccacgtcg cccgcgccgc taacctttgc ccacaatgcg accattgcgg cgactgagcg    101040
     gagggagaat ggacgtaaaa ctaaccgccc cgctacggca gatattggta aggcgtatga    101100
     cctggcttac gaggggttga attgatccat ggctcttgat atttcaaatt tgccacaaga    101160
     agccatcagc gcactaaagc aatttccaga gtttgagatc gcttcattca acgactctgg    101220
     agcgaacgga tatgtactta ttggccggca tagcgtgctc caaaaggaag ttgctataaa    101280
     gatatatttc cacggggaga gtgatattga tcaagagcca acgattattg caaagataaa    101340
     tcacgaaaat gtcctgaaag tatacgacgc aagaaaagtg ggaaaagatt gctcatattt    101400
     catgacgcca gcggccagtg aaggtgatct cgcaaatttc ctagatacgt attttatttc    101460
     acttcctctg gctcataagc tgctatgcca acttttatct ggaattgcgg cattgcatat    101520
     gagtccgaat ttgcttgtgc atcgggattt gaagcccgaa aatctgttgg ttcataacga    101580
     caatctcttg attgctgatt ttggttcagt tcggcgaatc gatgagaaaa cgggtagtgc    101640
     accggcatcg aagcacagca ttttgtatag accgcctgaa gcttttggtg aggactcatt    101700
     ctttaatttt tcctcagata tctaccaagc cggacttatt ggatttttgt tatttggtgg    101760
     gtccttgagc aatgatttgc ttagttattt gacaaaaaaa caaaaatcgg agcttactgg    101820
     tattcagggt gggtatgagc tatccattta tgtggattct tgcatcgaaa aaaaagtttc    101880
     acgcggaaat ttggctgact tttctactct tcctttttac attccagcgg ccattaagcg    101940
     cacattgaga gcagccattt cttccgccga caaaagatat tccagtgtca gcgaatttct    102000
     cgcagaatta tctcgattaa gaggaaatat gccagattgg tcgacccgac gtgagggtgt    102060
     tctgcttcgc aattggaatg gactagacta ccgaattccg cacgacgaag tcgctatatt    102120
     gaagtgcaaa tcaggagccg aaaagtatcg ctacgacaaa agttataatt gtggcagcta    102180
     tgctgagcta ttcgatcaaa tgaaggagcg actcgggctg ccatgaccta tttatggcac    102240
     acgccggccc tcgacctcga tctgaccgac gccccgctgc aggccgactt ggccgagttg    102300
     cgcgcgcgtt ttcctgagac ccgcacgctg taccgcgagg tctgcggcct gctgttcttc    102360
     cgctacggcg tcacgcccac cgacaacaag ctctacagcc aggtgcatgg gcaagcccgc    102420
     cgaggtgctg caggcgttct ggcaggagct gcggggacgc acgcgcgtca ccatcgacca    102480
     tcccgacttg ccggagacgc tgagggacat cgcggccggg ggcggggcag accatctggc    102540
     aggcggccaa cgaggcagcc accaccgagt tggccacgcc gcgcgccaaa ccatcgagtg    102600
     gggtcaggcg acgctggccg cggagcgcca ggctcacgcg gcgacgcagg cgcggctgga    102660
     gccggggcgg gcggaactgg acgccgccgg cagggagctg gcaactgcgt acgcaattct    102720
     cgaccgagct tgagcgtgcc cgcgagcagg tgagtgggct gaataatcag cgtagtgtcg    102780
     acttgcgaga ttccagccgt cgccttggca actacgctga tccatttgag gcgggttctc    102840
     agcgttgaag ggaggaccgg ccctcgctca tgggaagttg ggtgttctgt tgcggagagg    102900
     cgaccgctac tcattgagtg cgggtcgaac ctctggaaat ggggcgcgga tgttaaactg    102960
     aaggcagtca accgccgtca catgtgctgt tgacgacacg gcttgcagcg cggatatcaa    103020
     cggtagcggg cagcgtcagt atcaacacgc cacattccgg aggaagttcg catcatggcc    103080
     agcgcagacc agatcaaagc gctcgtaaaa tcgcacatcg atcaggacga tgggaagttc    103140
     tattcgattg cgatgcaggt ggctgcccat gaggccaagg tggggcatgg ccgattcgcc    103200
     gtagagctgc gggatatggt cgactcggcc aaacaacggg cggcgcggcc gacggcaggt    103260
     caaatagtgc ccattgcacg cccgcgtggc gagattgcga atctcctcca tgtgagctac    103320
     ccgtcgaacc gactggcgga tatggtcttg gatgacgggg ggcgcgagca gttgcagcgg    103380
     atactgaaag agcagcgcat gcttacgcgg atccgcgagc acggactgtc tccgcgtcgc    103440
     aagctgttgc tggtcggccc ccctggtacg gggaagacca tgaccgcttc ggtccttgcc    103500
     ggcgaactcg ggttgccgct gttcctggtg cgtctcgatg cgctgattac caagttcatg    103560
     ggcgagacgg ccgccaagct ccggcaggta ttcgatgcca tctcggacgt gcgcggcgtg    103620
     tacttcttcg acgaattcga tgcgattggt tcccagagag gcatgccgaa cgacgtcggg    103680
     gaaatccgtc gggtgctgaa cagcttcctg cagatgatcg agcacgatca gtcaaacagc    103740
     ctcattatcg ctgccacgaa tcatccggag atcctcgact acgcgctgtt ccgccgcttc    103800
     gacgacgtga tcgaatatca cgtccccagc gtagcgcaat ccgcgttgtt gttgcgttcc    103860
     cgactgggct cgtttgcgcc gaaatccttg ccgctcaccg cgcttgccga gacggcgatg    103920
     gggttgagct atgcggaatt gcgccgggcg gtcgacgaag cgatcaagga agcgctgatg    103980
     cacgacgagc cgaagatatc gacggaggcg ctggaagctg cgctggtcga acggaagaag    104040
     ctgaaccaga gactgaacaa taagaactcg caaccacatg ccggtcccgc cgcaaaataa    104100
     gcgtcgccat ttactgccca cgggcacatc cacttcttct ccatttactg cacatgccgc    104160
     caatggccgc ggtcggcctg tcgttcccga cttgccacgg cagcagcatg gacaaacgct    104220
     ccaggcgcaa atcgaacggc ttcaggcggt cgctgtggcc gcccataccg aacaggctgc    104280
     cctgggcctc tccagcggcc ttggcgtcca aatccagttt gcaagccagc ccaatgttga    104340
     gcttgcagtg cagagcctca gcgccgagcg cggcaacccc cggagtcaca tcgagcttct    104400
     gagcgtacgg caggacggcg agcagacttt tgccagcgtg ttcgtccccg aggggaagct    104460
     cgcgcatttc gagggctatg tcgcggatta cctcggcgaa aagaagaaca aggccggcgg    104520
     gccactcgac cacaagccgc tgatcaatac cattgccgcc atccagccga tcgaaatccg    104580
     cacgctctgg accgacgagc ccgagctctt gccaaaagat caggacgaag gtttttggtg    104640
     ggaggcgtgg ctgccggtcc ggggtaaccg aaacgcggtc attggcgatt tcaaggcgtt    104700
     gatgcagcgt gccggctgcc aggtgcccga caagcagacc gattttcccg agcgtacggt    104760
     ggtgctcatg tatgggagcc agaaccaggt caagacctcg ctgctctccc tgaactgtgt    104820
     cgccgaattc cgccgcgcca aggaaacggc cgacttcttc gatacgatgg gcgttgaaga    104880
     gcagcgcgat tggcagcagg atctaatcca gcggacgcat ctcgctgccg ccgaggatgc    104940
     tccgcggctc tgcctgctgg attccggagt gaaccgcggt catgaattac tggctcccct    105000
     aatggccgag gatgacatgt actcggtcga gaaggatggt cggaccgatg acgaggcgaa    105060
     tcacggtacg ggcatggcgg gcctcggtgc atatggcgat ctcaccgagg cgatcgagtc    105120
     gaacgcgccc attgcgattt accaccggct cgagtcagtc aggctgctga aggaggcggg    105180
     tgcgaacgct ggcgagcctg agcttcatgc gcagctcttt ggtgaggccg tctcccgccc    105240
     ggaaatttcg tacccggacc gcaaacgcat cttctgttcg gccgtcacgg catcggacta    105300
     ccgagatcgg ggccgcccct cttcatggtc ggccaaggtc gatagtctgg ccgcagatgc    105360
     cgacaacgaa ggacagtttc cgcggctttt tgtactgtcg gcaggcaata cgaacgatat    105420
     cgatgcgtgg aacgcctacc cggacagctt gtcgacgaat ctgatccatg accccggaca    105480
     agcctggaat gccttgacag ttggggcgtg taccgccaag acgactgcgc atgcaggcta    105540
     cgaagcgatc gctgaagagg gcggcttgag tccgtattcg acgacttcgg ctgcctggca    105600
     aagcgcatgg ccattgaagc ctgatgtcgt catggagggt ggcaatgtcg cgcgcgacaa    105660
     ttttggtgcc atcggcatgg acagcctgca gctgctgtcc gcccaccatc tgccccgtga    105720
     acgagtcttc accacgttca acgcgaccag tgccgcagca gccctgtgcg gaaagctcgc    105780
     ctcggaaatt gctgcggaat atcctcagat gcggccggaa accattcgcg ccctgatcgt    105840
     gcattcggcg gaatggacgg aaggaatgcg caaggcgtat ctgcctgcgg cgcaacccgg    105900
     caaggcggcc tatgcgcgtt tgatcaggca ttgcggatgg ggcgagccgt cattggaccg    105960
     cgcgctctgg agcgcgtcca attcgctgac actcgttatt gaggatgcac tgcggcctta    106020
     taaaaaggag cgcggtgtcg gtcccgcttc gcgggagatg aacctacatg cgctgccgtg    106080
     gccgcgcgag gaactggagg cgctgcaggg gctgcctgtc caaatgcggg ttaccctttc    106140
     ctactttatc gagcccaatc cgtcagcgcg cggaagcgtt tcaaagtatc actacccgtc    106200
     ccatcgtctg cgtttcgacg tgcagcgccc gctcgatgcg acgacggaag cgtttgtggc    106260
     acgcgtgaac gctgccgtcg agcgtgacga tgaggatcct ctaaacgctg cggacgcgga    106320
     ctggtatctg ggtgatcggc agcgccatcg cggctccctc catcaggacg tatgggaagg    106380
     cacggctgcg gaactggcga gccggggggt cctcgccgtg tatcctgcac cgggatggtg    106440
     gagaacccgc ccgggactgg aacgctttga cagcgtggcc aattacagtc tgattgtttc    106500
     catcaggacc gagcagaatc aggtcgacct ctacaacgca atcgcaaacc aaatcgcaat    106560
     agtaaaccag gtgtgagaag acgacgcgac tttatcgctg attggctgct cgtccgagtc    106620
     agccataaag gcgttgagaa ggccggccag gtgttgcgga agtttgtccg ccgccttctg    106680
     agtaaccaat cccgcagtaa ccaatgtacg ccggatagtg ctaccgctgc cccaagctgt    106740
     cgaggaatac ctgtcgcttc tggatcgcga tgccgcgccg ttgaacctgc ggtgtcgacg    106800
     cgcagatttt gcagaatgca ggtgatccgg cggcactggc gacgcgtcct tgttcccgag    106860
     cacttgacgc tcgggtaatt gcacaatgtc atccaggtca tacctcaggg cttgcggagc    106920
     gaacgcagga acaggtaggt cagaagtatg cgagatgggg tcttctgaac aaagaagtaa    106980
     ggctgcggcc tgcctccgaa tcccctgaag aagcgctcga ccggctccag caccgaacct    107040
     tcgaagtcaa acgtgcgcgc cacgccagag gcaaagcgga tggcgtccca aatgcacagg    107100
     ctgctagcgc cgctggtgcg cagcttcggg tccgagccgg ccattaggta ataggcgact    107160
     tgtccgtccc agaccagata gacgcctgca tgacggtagc cctgtttatc cacggcaatg    107220
     aagatcttgc gggcccctcg cgccgcgcat gcagcgtcca ggcggcgcac gtagtcgtcg    107280
     gtatatggca acggcatgcg ttgccgggtg aagacctgcc ggttaagttg gatgaactca    107340
     tcgataccga ggtcgtcgcg cacctgcaga ccatggcggg agcccgcttt acggatttcg    107400
     cccctgatgt tgtgctgcat gccattccag agcgcggccg tatccgacag gtcatcgagc    107460
     acgtacgtgt acttggtggt ctggcggaat cccttccagg caaagggcag ccaattggtc    107520
     tggctgggat cccagtgctg ttggaaatgg tcgaaccgcg gcagttgccc aatcagttcg    107580
     tccatcaact ccttctgttg acccagcatc ctcgccggct ttcccgccat cggtgccagc    107640
     cacggtccgg ccatcttggc cagcgctggc tgggcgatta ctgagaaccc atacaggcgc    107700
     cggggggcgt agggaaggct tgcgaccacc tgtccaccgc gttccaccag ggcaacgccc    107760
     cagttcccgg gaccggcggt ggcatccagc caccacgcct ggctgaacag gggaatattg    107820
     gccgtattgc aaagctgacg gtatcggcgt tgcgccgcgt cgcccccagt gtctgtgtca    107880
     gggatctgct tgactgaatc agcgggccca cttgcggctg gtgcattagg atcagcataa    107940
     ggtttgcgca gatcgtcgaa catatcgggt ggcttcctcg aaaagtttcc ggcccgtcct    108000
     catgccacgc accttaactt cggcgagcgg tagcccgcgc ctgaagctga aatgacgata    108060
     cattgcattc ccacgcagac gacgaggcgt tggtgtatta ggcaacaaaa ccatatgtat    108120
     gagcttgcaa gcagccaacc atagggagct caatatgtca tggcgaagag agggctcagt    108180
     gctcacaacc atacttagcc cggcaagttc ggttttccat ggtacgagtg aagccgtgct    108240
     tttggatgga ccttgacccg caaggcttcg ccaagaagca gctctggttc ccaactttgg    108300
     agggggcggt cgccgcaggc tgggcgctgg ccaagcgata gaatgcagaa ctgcacatag    108360
     atcgacacga cgtagccttt tccaataagg aacggaatgt cagaaacaac caatcagtcc    108420
     ggaaccgcta cctggtcgta tgaagagctt acggcaatca cggaggagtc cctccgcctt    108480
     cttctggaga agtcccacgg ggacatctcc actggtcgcc gggacgagtg ggtcgcgtat    108540
     ggcctttatc ttgggtggtc aaagcagact gaaggtcgaa ggaagcgtga ggacgatgag    108600
     cggctgtaca aacttaccct gcgattcagg ggcgcaggtt agacggactc caacctggag    108660
     acatcgctga cataagcgct aagggtcgct cccccgaaag gcttccaacc tctgcgacta    108720
     tatgtccgaa aatacatcac ccaattgtgg tatgaatccg gaagcatggg tatacttgcc    108780
     tccgggtaca catttcatgt tgtcccacat cccgttgaac ccccggtccc ccgggggttt    108840
     ttttcgcggt atcagaatgc tgaccggccc gagcggctgc gatgaagtag tcgcgattgg    108900
     cagcacggct gtagaggctt ggctgggctg gattgacctt ggttagcctt ggatttgcga    108960
     gttgcgagtt atgcaaggcc ctgatttata aagcgttatc ggccacgcac gatgcgccga    109020
     ggtgccgttc cgttgtcttg cagacatttg tgtgtcctca cgctgcgttt cctaaatgaa    109080
     acttaggata gtgctgtgtg tgccgcgagc aagttacggc cggcatcaat gccatcggtg    109140
     ccgtgatcca gagtgcaaat caagcaggcg aggacagagc cggacgcgtg cgctagcgtc    109200
     ggacgttggc gtcagggacg caaacagagt gaacatatgg cacacccaaa gcagctcact    109260
     cctcgaacat ggaacggcgc tgagggcgct cccggactgt agctaaattt cacctgacag    109320
     gcttggatgg ccgtgattgg cttccggtaa cctttgtttt gcaatttgcg agttgcgcaa    109380
     ggcgctgatt tataaagcct tctagtttgt caccaaaact cgttgcgatg gcggcggtga    109440
     tgggtgcggc gcttgcggcg gtgggatcgg caattcgagg atgcgccatt ggcgcagcgg    109500
     ctgggtcagg tcgtcggcga gtaatagcct acgatcatgc catgtcagat gccagctgct    109560
     ctccatgata tgcttgtgct cccacttcat gggcctggct catggggtga tccaacaggc    109620
     gctccagcat gtcctagaaa caggcatagg gctcgatcag caagtgaatc tgcgcgtggt    109680
     cgcctcgcga aacgtctggc ttttcctgcg aagctgacac cagctggccg ggttcccgat    109740
     aaaggacgcg aacttgtcga atcaagcatc aaggcgcttc aaagttcatg ttgctcttgg    109800
     gtccatcagc atagtcgatc gacattccct atttgagatc gagatcccga atcggcggcg    109860
     gatactcgaa agccataatg gcctccaggt ttccgctagc ggttgtccta aacacttcaa    109920
     taaggaagcg acgcccgtcg tgatgcacgc cactaacgtg gtaataaaca cgacccttcc    109980
     actgcgtcaa gccgacctcg agtggtaatt taacacctaa ccggcgcgca tagttgttca    110040
     aacgaggatc ggaaactaga tcattaaggt tgcccatgtc gctcagcgct gcgccaattg    110100
     gcgatccaaa gaatcatagt tcgatacaaa ccgacatgca aaaatcgata aatgtctttc    110160
     aggtttcaaa tcgatcttgc aatttctaca ttcgaacttt tgcagtcttt gcatgatttt    110220
     cataaccagg agccacgggc tgaccaacga acagctgcat atgtcagcat ttgcggccgg    110280
     cgttcagtga gagcttacga ggccgtctta cagttctccc gcgaagcaaa cgaaatgcca    110340
     cagaggtagt ttcgcttgtt cggacaaaga gccggagttt ataagtggaa gcgctggtgc    110400
     agtcaggctg ccgctttgat tgctcgcagc gtggcgaagt atgccttatc cgggatctgg    110460
     tctccagact ggaatagggt cgtcgttcgt tgtaccaggt cacgtagttc gcgatagatc    110520
     cgcgcgcatt gctgaccgag tcgtaggctt tcagatagac ctcctcgtat gctgcgccaa    110580
     agtcgttcga cgaacacgtt gtcgcgccaa cggcccttgc cgtccctcga cagctggatg    110640
     ccgcggccaa gcacggcgtc ggtgaactgt gcggcggtga actggctgtc ctgaacggtg    110700
     ttgacgatct ccggcgtgcc gtatttggca aaggccacct caagcgcctc gacagcatgg    110760
     ccactctcca gtgtgaatcg ccagacctga cgccttcggc ccccgccaag aagacacaac    110820
     tgggggcccg cagctttttg actttgccga ttcgcttcac tagattcgaa tcaaacgatc    110880
     gaggaacaag cattgatggc accgagcgag ccccgaagtg gcgcttggtg tacattcaga    110940
     atgcagggaa acaaccatag gacaacaacc atgaccccct gggaaattca aggtaccgag    111000
     ctgattaact gcaattgctc atacggttgc ccttgccagt tcaacgcgct accgacccat    111060
     ggtttttgcg aagccatggg tgcgatttcg atcagcaacg gcttctatga cgtcgtgcga    111120
     ctcgacggcg tcaacatcgc ggtggtgttc aaatggccgg gtccgattca cgaaggcaag    111180
     ggcaagtgcc agccagttgt cgacgaacgg gctagtccgg agcaacgtga tgccgttctg    111240
     aaaatcatgt cgggtcagga taccgagcca ttcgcaacga tgttctctgt tttcgcgtcg    111300
     acgctcgaac aggcttacga tcctatcttc acgacgatcg atttcgacgt cgatgttgat    111360
     gcgaggcgcg gccgaattca tgtcgagggg gtattcgaca tcgtgggaga gccgattcgg    111420
     aatccggtga cgggcgccga gcatcgcgct cgaatcgatc tgccgctcgg cttcgaatac    111480
     gagattgccg aaatcggctc ggggacgagt cgctcgcaag gcaatatcgc gctgaatctc    111540
     aatagcacgt acgcgcagtt cgcacgactg catatgaaca ataaaggtct catccggcat    111600
     catactgcca catgagctgc atcgagaatt tcctcggccg tgagcgcgta atcacagcac    111660
     ttggtattgt tgctgttatc gtgtcgtcgt ggtactactt gtggactggt gcgggaacgg    111720
     ggatggctgc actcgacatg acggcagtcg cattgttccc gcatcggctg gcagatggcg    111780
     gcagcatgga aatgtcgcta gcgaccgtgg tcgtgatgtg gtggacgatg atgatcgcaa    111840
     tgatgacgcc cagcgctgca ccgcttatct tgctgtatcg gcgcgtcatt cgatattacg    111900
     gcgcgccgga atcgagatca ctcgttccgt cgatgcttct tttggctggc tatctgactg    111960
     cttggcttgc gttttcgatt tgcgcgacat ggctgcagat gatcctgcag cccaccgggc    112020
     ttatctccgc catgatgttg tggtcgaaga gcgcggtcct ttctgcaatc gttcttgctg    112080
     cagcaggttt ctatcagttc acgccgctca agcgcgcttg cctaaagcag tgccgttcgc    112140
     cggcgaattt ccttactaag cattggcgct cgggagtcgc gggaagtttc ctgctcggca    112200
     tgcgtcacgg ggcgtactgc gtcggctgct gctgcttgct gatgacgctg ttattcgtgg    112260
     gcggggtgat gaacgtcttg tggatcgcgg cgctgtcgct gatcgttttc gtggaaaaaa    112320
     tcgtgccggg cggcgatcgg ctcggccgcg tgctaggggc ggtgttgatt gcctgggccg    112380
     gtgtgacgct gctggcatga atgactgtag attcgcctcg acaggtgtca agccaaacaa    112440
     ctatgagcaa gattctgctt gaatcgaccc tcacttgccc gcactgtggc tgcgtaaaaa    112500
     aggaagttat gcctacgaat gcatgccagt tctattacga gtgtggccac tgcggtgcag    112560
     ttatgcggcc gaggcggggt gactgctgtg tattctgctc gtacggaaca gtgaaatgcc    112620
     caccgatcca acagaaaaaa ggatgctgcg tctcgcttcg cggggcgtga actggctgga    112680
     gttcaggaat aggagtagat gacccttggt ctgagagtgc cacatggata gagaaagcgc    112740
     cgcgtggcct gtgctcccct ggttcacata atgacaatga ctccaggaat cgcaggagcg    112800
     tctcgggtgg ccggtaccga gctcgctgcc catctagcgg attcatttga gcgcgctcgt    112860
     tcttcatcgt caggcttcgg ccgagcaacc attcaatctc agttgccctg acgccggact    112920
     gcaaccatca ccatggcagg cgaatgagta gtgccaacaa gggatccagc ttgatgtggg    112980
     aaaaaagaac ccgccggaga ggcgggcagt tcaaaggagg taaagtgaag gatataacct    113040
     tcgattccag catacatgga acgtgggccg gcgcgctgtc ggattgtgtc tgattacgct    113100
     ggcgccccat ctcatgaagg gactgcttgc gacgtctcat gctatcgcat gatttcgtct    113160
     ggcaagatgc ctcgaagacc ttatgctgga ggtcgcagga aaggggccag tgaccttcgc    113220
     tcgactcgcc ttgaatacag gcggtcttct ggttaaggcc cacgatggtg ccgatgtgct    113280
     cgtgcaaagg ctgatcggtg aggagacggt atcgccgagc aggaagtctg cgcgctgcgc    113340
     tcgttgcggt gagggcggta tgcgtgcggc ggtggctgcg gcgtcacggc ggcgtaggaa    113400
     aagaccgggc cggcgcgtta aacgtccccg accacagcat ggatcagatg gtctgcgatg    113460
     tagcgacagt catgccgata tgcaaattgc tggtgcggtt gatcattcgg tcagatactt    113520
     aggtgcaggg cagcaaggat gtccatgatg cgcaatgtag cggctagcgc ggcggcgcca    113580
     gttttgtgga tctggctgac cgggcgagat ggtcgatcgt ctaccgttca tctagaatcg    113640
     cacgagtcca ttcaacttgc ctttcagcga tctgccgatg agcgattaac aaaaataatt    113700
     cgatgaccca gtccgccacc gctcattact tcgtcgaaag ccccagtaca ggagccttgg    113760
     tgctcggcgc ggtcggtgtc gtcttcggtg atatcggcac tagtccgctg tatgcactaa    113820
     aggagtgctt cagcaaggaa cacggcatcg ccttcagccc tgatgccgtg ctgggcgtca    113880
     tctcgattct gttctgggcc atgatcatcg tggtctccat caaatacgtg gtgttcgtca    113940
     tgcgtgccga caacgacggc gagggtgggg tgttggcgct gatggcgctg gtgctgcgca    114000
     ccgtggcgca gcgctcgagg aaggccaaga tcctgatgat gttgggcatc ttcggcgcct    114060
     gcatgttcta tggcgacgcc gtgattacgc cggcgatctc ggtcctgtcg gcagtggagg    114120
     gacttgagat cgcggctccc cagctttcgc aattcgtaat accaatcacg ctggtgatcc    114180
     tggcagcgct gtttctgatc cagcgccacg gcaccgcagc ggttggaaag ctgttcgggc    114240
     ctatcatgac gacgtggttt gttgccttgg gagcgcttgg catcctcaac ttggtccagg    114300
     caccggagat tctgaaatcg atcaatcctt attacgccat tagcttcttg gtcgagcacg    114360
     ccctgcaggc ctttatcgtg ctgggctcag tatttctggt gctgaccggg gccgaggcgc    114420
     tatatgtcga catgggccac ttcggcgcgc gcccaatccg catcggctgg ttcgtcctcg    114480
     taatgccgtg cctgatattg aattacttcg gccagggcgc gatgctgctg cacaacccgg    114540
     ccggcgtgga aaacccgttc ttcctgatgg tgccggaact actccagttg ccgatggtgc    114600
     tgctagcgac cagcgccacc gtgattgcct cgcaggccgt gatctcgggt gctttctcgt    114660
     tgaccagcca ggcgatccag ctcggcttcg tgccgcgcat gcgcgtactc tatacctctg    114720
     ccgccgaaat cggccaaatc tacctgccgg tagtcaactg gctgttactg gtgctggtga    114780
     tcggcgtggt catctcgttc aagaagtcgg agaacctggc tgcggcttac gggatcgccg    114840
     tgaccaccac catggtcatc accacctttc tggcagcggt atgcatgcgc aatgtgtgga    114900
     agtgggaccc ggcgcttgtg gcggtgctgg gcactagctt cctgctggta gatctagcat    114960
     tctttgccgc caaccttctc aagatcgccg aaggtggctg gttcccactg ctgttgggca    115020
     gcgctgcatt ctttatgctg atgacctggt acagcggacg caagctgctg cgcgcgcgca    115080
     gcctggaaga tggcattcca ctggagccgt tcattgccgg cctgctggcg cacccgccgc    115140
     atcgcgtcga gggcaccgcg gtattcctga ccggaagcat cgacacggtg ccggtgtcac    115200
     tactacataa ccttaagcac aaccgcgtgc tgcacgaacg tgtggtgttc ctgaccttcg    115260
     ttacgcgcga catcccctat gttgatgacg accaacgcgt cagttgcaaa gacctgggcg    115320
     gtggcgcctt tatcctgaag tcagaatacg gcttcaagga aacgccggac gtgcagaagg    115380
     tgttggacct ggctgaccgc aagctcggca tgcatttcga gttgatggaa acgtcattct    115440
     ttatcgcgcg tgaatcggtg atcccgtcca ggcttccggg catgccgatg tggcgcgaaa    115500
     gcttgttcgc ctggatgcat cagaacgggg caaagccatc ggattttttc caaattcctg    115560
     ccaaccgtgt ggtcgaactg ggcaccaagg tggagatata aacgaaccgc ctgtattagt    115620
     ctattgccgg gcgctacata cttagtggtc agataagacg ctaaattaac ctcacagcga    115680
     atgctcgtca ccgaacagat cgctccgcat ccatcgtcga tttcctctct ccgcgatggc    115740
     cggcaacgaa tgcggcgcca ttcagtccgc gcgccgacgt atcgggtcag ccaccgggta    115800
     aaaggggtaa aagcgtgcgc gtgccctcgg cattggcgcg ctcggcggca aagcgggcca    115860
     gcaccagcag cgcctcgcga tgccggaaga acagggtctc gggcaccacc accgcctcga    115920
     accctattcg atcgccatag ccctgctcga tgccggcgtg cccacggcgc gcttccgcat    115980
     cgacgcggtc gacgttagcg cccgtgcgct ggcgcgcgcg ccatggcgag tacggcggca    116040
     acgccttccg cagtggcccg ctggatttcc gtgaccgata tttcaccgcc ggccctgcag    116100
     gctacgcgct ggacccgcgc gtgcgtgcgc aggtgcggct gccaattcac accacggttg    116160
     ttaccgatag cccgtcagca actgcttcat ggcccgaaag gccgtagcgc ggtcatcgcc    116220
     gagcagaaaa gcgtggacgc ccagttctcg ccagtgctcg cactgcccga tagcgcgggg    116280
     gatggcacag aaaggcacac cacgcgcctg gcaggcttgc gcgatgcgct ggattgcggc    116340
     ttgaactgag ggatgctgcg catcagccgg cacgccaaaa ctttgcgaca ggtcgatcgc    116400
     gccttcgagc accatgtcga tgcccggtac agcgacaatt tcgtcaatgg cgtctacacc    116460
     ttcccggtcc tcgatcatgg ccaccaccat cagctcccag ttggcccgct ggaagtaggc    116520
     cggcaacgtc agcgtgccga agccggtcgt ccggccccca gtaatgccgc gcgtgccgag    116580
     cggatggtag cgggtactgt tgaccgccag ctcggcctcc gcccgactgc gcacgtgggg    116640
     caccacgatg ccctgcgccc cggcatccag cacgcgcaga atgatatccg gcgccgcccg    116700
     aggcactcgt accagggcag tgatgccggc gcattccgcg gcacgaatca tgttttccag    116760
     cgtctgtgga tttaccccaa cgtgctcaag atccaggatc acaaagtcga agccggcata    116820
     gccgatcatt tcggtcacca gcggcaatgg cagggaattg agcagcccga acacctcgcg    116880
     cccggcagcg agtgcggcct ttagccggtt aggctgcagc atgagcatcc tccgcagcaa    116940
     ggtagcagtg ctgcgggtgc gggtggcgca ggaagtcatg gtgcgagata tgccaggcgt    117000
     aggcgccggc atacgggaac accaccatgt ctccggcacg cacactgtcc accggcgcgt    117060
     cctgcgcgag gacgtccttc ggcgtgcaga gctggccgac cacgctgacg cgcgcgtccc    117120
     gcacgccggg gcgggcaaac ggatagcgcc acgactcgac cggcagcacc cggaacgggt    117180
     ggctgtgccc ttgcgcatag ggcgtgcgga agtggtgcgt gccgccgcag gccacgacga    117240
     aggcgcggtc gaaggcgtgc ttgacgtcga tcacttccat cgcgtagtag ccgcagaagg    117300
     cggtgatata gcgcccgcat tcaaggcgca cggtcagccc gtcgcgctgc gccgacagcg    117360
     ccggcaggcc ttcggcaaag ccggcccagt cgaactgccg ctcgggctcg cggtaattga    117420
     cgccgatgcc gccgccgacg ttgacctggt ccagcgtgtc gagcccgtat tccgcgcgcc    117480
     agcgcctgac ctgttgcagg taggcgtcga gcaggcgcag gtgggcggcg gcgtcgagct    117540
     ggtgcgacat caggtggaaa tggaagccgc gcagacggat ttccgggtgt gcgcgcagcc    117600
     acgctaggca cgcggggagc tgatctccgg cgatgccgaa cggagtgggc ttgccgccca    117660
     tcatcagcgt ggtggcctgc aggccttcaa tggccaggtt gacgcgcagc agcaccgggg    117720
     cggtgacgcc gcgcgcgcgc gcgagccagg ccaggcgttc gagttcatgc aggctttcca    117780
     cgtgcagcgc ctcgacgccg agctccagcg cgccggccag ttccgcatcg gtcttgccgg    117840
     ggccgctgaa gatcagcggc acgtcggcaa aatgctcgcg cacccaggcc agttcgccgc    117900
     cggaggaaat ctcgaagccg tgcgccagcg gcgccagcgt ctgcaggatc ggcaggtcgg    117960
     agttggcctt gatcgcgtag aacagctcga aacccggcgg caggccgcgc gcggtggcgg    118020
     tggcatggcg ccgcagcgcc tccaggtcgt agacgtaggt gctgagcggg gcgctggcgt    118080
     tggcaagcgc atttgcaagc gcgttctgca ggtggtcggt gacgcgcgac cagcgcagtt    118140
     cgggggcggt cattgccatg ccgcctccac gccggcgaag ggaatgggat tggcgacggg    118200
     cacgtaagtc gaggcgcggt cggcgcgctg gaagaagcgg ttgctgaaat tggtcttggc    118260
     cgggaacggg ctgccggcga gcaggccgtt gatgcgccgg gccgaggccg cgttgccgta    118320
     gcgatgctgg taggtatgca agtgatggcg cacgaccgac cacagccgcg tggtcatggc    118380
     cgggcggctg ccacccagct gggcgatgac ctcgcacagg ttgttgacga acaggcaata    118440
     ggcgacgcgg ttccagccct gttcttcgtc gtaccacagc gacgaccgcg cgcgttcact    118500
     gagttctggc atggaagacg cgggatggca cgacggcgtc agcttcaccc cctcgaagtc    118560
     gcgcaggaag agttgcgcgg gcaggtcctg gcgcaggccc agcaccacgt tctgcaggtg    118620
     cggttcgaag atgacgccat gcgcgaagaa gagatggaag accgggtaga gcagttgcga    118680
     cacataggcg gagaaccagc gctcggtcat ggcatccacc gtggtcccgg cctgcgcggc    118740
     gagcgccgcc agcagccgct gcatgcgcgc ttcgccgtag taatggttgc cgaacagcga    118800
     gccggccagc agcggcacgc agtcgggcgc gcgcagcgta tccacactct ggcgcaggat    118860
     caggccgaag ccttcgatga cctggcggtt ctgctcggta tcggcgtcct tgaggtcgac    118920
     cgacaggaag gccggctcct ccatcagcgc caggcctggg aacagccgcg ccaggtccgg    118980
     caacagcgga cgcagcacgc ggttgacgtg catggcgctt tccagctcgt accaggcgtt    119040
     cttgcgcacg cagttggtaa tgcggatgtt cagcgacagc ttgtagaagt acgggttgcc    119100
     gggctggtac agggtccgga tcgacgaggt gggaaagaag tccgcgccct gcgtgcccag    119160
     gtcctgcagg cggccgctcg ccagcgcatc gtgcaccagc ggatgctcgc gcaggtagcc    119220
     tgcctgccag gggtggaccg gtaccgccac gcggtcggcc ggcacggcgg gggcattcgc    119280
     tgcgatcaac tggtcgcaac tggcgtcgcg cagcgactgc tgcgcgatgt cgccgcgcgg    119340
     caccgcgaac catgccagcg gaaagcgggt gcgcaactcc ggcgagtagc gcagcaggtc    119400
     atcgtcggag aagccctgcc ggctcttcgg cgtggggtgg aacggatggc cgaaggtcag    119460
     cgattgctcg gaatcgatat aggcctccac cggatcggca ggaatcgtgg cgggcaccgg    119520
     cacggacagc acttccgtgc tcacggcgac gctgttgcgg atctgctcca tcagctcggt    119580
     gttgggcggc agctcgtgct gctgcgccat ctcgcgcaac agcagcgcgg ccagcgcttc    119640
     ccagtcgagc agtgcccacg gcttgttctc ggccttgtgg aataccggcg agaggtagcg    119700
     gtagttgccg gtcagccagg caccgccgac cacggacagc agccggccgt ggatatgcgg    119760
     cagctgcact tccagcactt gggccggctc gcgctgcagc gtcatggcga tggtcgcggg    119820
     ccagtcgttg tgcccggcgg gcgggccgac gcgcaactgg ccggcggggg ccgcgacctc    119880
     gcggcagtag cagttcagca gtgtttcctg gcagcgccgc gcggcggcca gttccgccag    119940
     ttccgtcaat acgcggcgcg tgccggcatg ttccatcttg gtttgcactt gcattgtctt    120000
     gtgacctcgt tctcgggagg gatcagagtg cgcttatgcg ctgtcgggcg gtaaggagca    120060
     ggtaggcgac ggccggcgcg agcagcgcgg cgcctagcag gtaaggcgcg cgctggccgg    120120
     ccaggctgac tgccgcgccg gcgccaagcc cggccaccac gccaccccat ttggaactgc    120180
     tttcgaacca gccgaaggtg cggccggcgt tgccggcgtg caccacgctt gcgaccagcg    120240
     catgcagcgc gataaagccg gccgtcatgg cgatgcccat cagcaggcgc caggccacca    120300
     gcgccggcag gccgagcggc gccgcttggg ccagcagggc gatcaccagc gtgccgtagg    120360
     cggtggcgag cagccccagc gacggggcca gccccagccg ccgcgacagc aacggtgccg    120420
     cggccaggta caccaggtgg ggcaggccga acagcaggcc ggccgtggcc gcggagatgg    120480
     caggcatgcg ctgctgcatg tcggggatga agtacgggaa cgtcaccacg gtggcgaaca    120540
     cgaaggcgaa ctgcagcacg tagatctgcc gcggcgtggc tggcgccgat acgcttgcgc    120600
     cgcccgcgcg tgttgccggg cgcttcgcag cgccggtggc ttcgccggca ggcagccatg    120660
     cgatcagcgc cgcggcggcc agcggcagca aggccagcca gcggtacagc acgatcggcg    120720
     attccgcccc catccacagg cccaggcagg cgggcgccgc taccagcgcg gcgcgcgccg    120780
     accactgcat cgccgtcagg ctgcgcgtga gcgtggtgcc gctggcgacc gttgccaggt    120840
     aggcgttgga ggccgagaac gtgccgccca gcacgccctg cagaaccagg gccgccagga    120900
     acgcaaacga gttggtcgca tagctggcca gcaggaagct tgccgccagc cccagttgcg    120960
     cgcgcatcag cagcggcttc ttgccgaagc ggtccgcgag ccggccccac catggcgccg    121020
     acagcgccgc cagcagcgtc ggcaccacgt agaacgcgcc cgcgagccac ggcacgtcgt    121080
     tatgcagcga gcgctgcagg atcagcgcga agaacggcgg catgcccagc gccgcgaagg    121140
     cggcgatgaa atggcatagc atcaccaccg cgaccacctg tcgcgtgccc gcgctcatgc    121200
     ggccacccgc aggaagttgg gcgcgcgctt gccgtagaac ttgttgacgt cggttgcgcc    121260
     ggtctgcgcc ttctccacca gcgatgcagc ggtcagcagg tacttgaggt gcaggcggtc    121320
     gtcgtcgagc agcacctggc gggcgaagcc ggtgtcttcg ccggcggcgg ccaggtcggc    121380
     aagcacggcc gccacgtggt cccgcacgcg cgcgtagccg gcggccggat cggtgccacg    121440
     acgctgcgca aggccttcca ccagcgccgc gatattcagt tgcagcgtga tggtgacgaa    121500
     catctgcgcc agcggcagcg cctcggccac gccgatgcgc tggtcttcca ggccgtcgag    121560
     gcgggccgcc agcgccggcc agcggcgacc gagcgtgccg cggtcgatgc gtgccgcatc    121620
     gttgtccttc agcagcaggc gcaagccatc gtcggagtag accagcatcg agttctgctg    121680
     gtttgactcc agggcaatgc cgtagcgcag ccatagcgtc aggtgcagtt gcagcgtgag    121740
     cgcgaggtag gcgtcgaacc aggcatcgag atcgccgcca tggtagcggc cggcgagtgc    121800
     ctcggccacg cagttgccgc ttgcggtctc ggcgagcagg ccggccaccg acaccacggt    121860
     ggcgttcgcc agttgctgct cggggtagcg gcgcaggatg tagcccagga acggtcgctg    121920
     gtccacatgg gcgccgttgg cttcatcggt gaacagcacc tgtccgttga ggcccggttc    121980
     gcgccggacg atatcgccaa gcagtgactg gatgcgatgg ccgtcgccga tggtgctggg    122040
     cttgatggtg cggatgttcc tggcgcccag ggtgcggatc gtgagcggca gcttgacgtg    122100
     ccacgcgggc gcatcgagca ggaccagcga gcgcaccgac agggtgggcg acacgcgcag    122160
     gtatgtgcgc ggcgcgcgga tgacctggca gtcgagcccg gcttcggcca tgaagccgtc    122220
     cagatggtgc tgccatacga acggatgcac gggcaccagc gcatgcgatg cggcgagcgc    122280
     gggatcgagg ccgacatcgg cgaaatccgg ccagttcggc ggcagcgcgt cgccgctggg    122340
     atgatggcgc tcgcgcggca ccgccagcca gttcaacgcg aatgcgggct ggaactcggg    122400
     cgcgtagcgg gcgagatcgc tggcggcaaa gcccagcttg gcgcgcgcgg tggggtagta    122460
     ggggtggtcg aggaagcccg cgacgcggtc atagtgcagc atgcgctggt cccatgccgg    122520
     cagcgcgtgg ccgtctgcgc tgtgcggctg cgcgaaccag cgcgcgcgtt cggccatcga    122580
     agccttgcgg tgctcgaccg ccgcacggca ttcatcggcg taggcggtga acagccgtgc    122640
     gtcttcggca ggaagatcgc cggcaaatgc ggccaggatg gcatcgacgt catgcagcgc    122700
     ggcgaacgct ccggcgtctt cgcgcagcag cggcgggcgg gtcaggcgcc attcctgcat    122760
     gtagcgggcg ggcgttaccg ggatccacac cgtcccggcg ccaaggtgcg ccacgcgcag    122820
     ccactgctgg ccggcgtcga aaccatgcgc agtggcggcg ggtatagcgg cagtgtcgcg    122880
     tagttcgccg cggctggcgc atgcgcggac atcttcgcgc agcaaggtgt cgacgacacg    122940
     aacgcaaata taagccgcat ccgcatccgg cgcggcagag agccccggtt cttcaggcag    123000
     gcacgcggtc attgtgtgat ctcccaggcg agcttgctac tggccatctc caccgctgcg    123060
     gcaagacctt tgaggtcggg accgctgccg cgcagcacgc ccaggtaatc cttgttcgag    123120
     ttggttagct gaatggcgtc gcccaccttg cgcagcggct ggtaggtcag gcgcacgccg    123180
     tcgccttcat gctggctgtg gcacggcgca tgcctcagcg tgccttcggc ctgggccgtg    123240
     aaatatcgga tccaggccgc ccgcttcggt acctcgagcg ccggcagggc ttcgcccagg    123300
     tgcaggcgca ggacctgctc gaacagcggg aactgcagcg tgtcggacag caggaactcg    123360
     cggtagtcgc cgatgctgcg gtagttgatc tcgatgaggc gcgggccctt cggggtcagc    123420
     acgtattccg tgtggcaggc gccgaagccg atgccgaagc ggcggatggt gtccaggact    123480
     tcggcctcga ccgacgccgg caggccggtg ccccatacgg cttccagttc tacgaagtac    123540
     ggcggcggcg acagggtcac gcggaagccg cccagcgcgc ggatctcctt gccatcgccg    123600
     agcgtctcca gcgtgtacag cgggccctcc aggtattcct ccagcagcag cgcctggccg    123660
     gggtgccgga cccagatcgc gccgcaatgc tcggccagtt cggcgtggct gcgcgccagg    123720
     ctgacctgct ggctggccac gccttcgcgc ggcttgacga tgcacggcat cggcacatcg    123780
     gcgagggcag tcaggccggc ggtatcgcag accaccgcat gccacagcgt gtcgatgccc    123840
     gactccgcca gccgccgccg catttccgcc ttgttcttgg cggcgtaggt ggtgcgccag    123900
     tccttgcccg gtaggccgaa gtaggccgct gcaatcgccg tggccgtctg caggtgatcg    123960
     ctgttggaaa agactgcgcc gggcttgcca cctcgtctgg tgatggcatc gatggcagcc    124020
     agcggattaa agacatcgca cggaacaata tcatccgggt aggcgggcag ccctgcgcta    124080
     gcgaagtgag cgcgatgggc atcggcgcaa tcagtcagca tgaccacgga caggcctagt    124140
     gctcgtgcgg caggcagaaa accttcgtta atgggggcag tagggacgtg ggcgagtaca    124200
     aagatctctt gcatcgatat gtagctttat gagagatgtt gcaaatacaa attgcaatga    124260
     ttcgtattac tgtcgatggg tgaaatttcg tcgcggccat gcgttgattg aggttgccgg    124320
     agctagagaa gggacggccc tgagagccgc cctctagtgg cttatggcct tacgacaagt    124380
     ttgtactgcg gtgtggatgc tttacatccg gtaccgcagc gtcgccatca cgctgcgcgg    124440
     ggcacccggc atgttcaggt tggagctggt gccatgcgcc gacacgatgt agcccttgtc    124500
     aaacaggttg tacacgttca gctgcgcctc gaacgcgccg cggcggtacc aggccatggc    124560
     gtcggcggtg acgtagccag gcagcgtcac ggtgttgagc ggatcggcat agcgcgcgcc    124620
     caccaggttg aggcctgcgc ccacgccgaa gccgtggccc aggtccttcg tcacccacgc    124680
     gttgcccgag tggcgcggcg tgatggtggc gcgcttgccc tgcagcgcgg cggtggactt    124740
     ggtgatggtg gcatccaggt acgcgtagcc cgccagcatg cgccagccgc cgcccagctc    124800
     ggccgcgccg gagatctcga tgccgtcggt gcgctgctcg ccgatcggca gtagtgccgt    124860
     gttggtggcg ttggccacct tgatgttgct gcgctccagg cggaacaccg agatcgtggt    124920
     gctggccttg ccgttcagcc agtcgtactt ggcgccgact tcagtgttgt tggtggtctc    124980
     gggcgccagg tcggcgttgt tggccgccag cgcaaaggcc tcacccgacg gctggaacga    125040
     cttgctccac gacacgtagt acgactgcgc cttcgacggc tgccacacca ggccggcgcg    125100
     cggactccag gcggtgtcgg tgcgcgacag gtcgcgctgg cctgcgatcc ggttcctggt    125160
     ctcttgctgg aagttgtcgt agcgcacccc caccagcgcc ttccactgct cgctgaactt    125220
     gatcatgtcc tgggtgtaga acgccagggt gtcgaacacg cccaggttcg aggtggtcgg    125280
     gttgcccggc gccttcagcg gcagcgtcat cagcaccggg ttgaacaggt cgaacactgc    125340
     cgggcggccg ttggcgccga gcaccggctt ggtgttgttg acctggtcct tgttctgctg    125400
     cccgatctcc atgccgtaca ggatctcgtg ctccatgccc aggaaggtgg ccttctgggt    125460
     caggtcggtc tggttgaacc agccatgttc ctcgcggcgg acattgccgt ggttcatggt    125520
     cagcgtgcgc gccgcttcgt tgaccgcgga ggtcagcgtg ttgttgcggt ccagcgagta    125580
     gtggtagtag cgcgtggcgt tgcggatcga ccagttctgg ttgaagcggt ggttgatcgt    125640
     ggcagtgccg gagaacacgc gcgactgcga gtagtcggca tcgcgcgcat tggccgcgcc    125700
     gtagtagcgc gaggccggca cgtcgaccgg gcggccctgg taggccggga tgccgaagtc    125760
     ggtgacgcgg cggtcttcca ggtagtcggc ctggaacagc acggtggtct caggtgcgac    125820
     gcgcagctcc agcgacggcg cgatcgcctt gcggtccagg aactgctgcg agcgatagct    125880
     gttggccttc tccacggcgc cggtgatgcg gaacgcggcg gcgccgtcgg cgaacacgcg    125940
     gccgacgtcg gcctcggcgc ggcggtcggc ccacatgccg tagctcagcg cgaaatcggt    126000
     gacgtcgatg ccaggcttct tggtgacgcg gttgatcagg ccaccggccg agccacgccc    126060
     gtacagcacc gccgccgggc ccttgaccac ttcgacgcgg tccacgttgg acaggtcgcg    126120
     gaagtacagc gcgtcatcgc ggatgccatc gacgaactgg tcggcgatcg cggtgaagcc    126180
     gcggatcgag acctggtcgc gctggccatc gccatgtgag aacgacacgc cgggcacgtt    126240
     cttcagcgcg tcctgcatcg acgtggcgtg ctggtcgcgc attacctcgg cggtgaccac    126300
     gttgacggtc tgcgggacgt cgcgcagcgg cgcttcggtc ttggttgcgc tgagcgcgtt    126360
     gggcgggttg tagccggcgc ccaactcacg gctgacgtcg gccttgacgg tgacctcggg    126420
     cagctgcgcc gctgcagtcg gtgtcgcctg cgaccaggct gccatcggtt gaaaaacgaa    126480
     agtccccgcc accgcggcgc agatcgggtg aagctttatt ctcattcttc ggctcatgtt    126540
     ttgtaatgct tcgtaatatt ttttgcaaac gcgacgcatt atcatttgcg tttgttggaa    126600
     ggtcaacctt ttcttgaacc aattggggcc gccgtcgtaa tctatgggcg gacttgcata    126660
     agagccttat ggagcatatc cacccgaccg gaagaattgc aggactcgga ttgtggccaa    126720
     gtgcgcgcta cggggggcgg actcggttca aggtggaaaa agctgcgtgt tgcgggggcg    126780
     gattggccgt aacgccagtt cgcgagcgga tacaaaggct tacaacgctc tcaaccgcga    126840
     gggtcaaccg tgaaaaccca ctgccgttac aggaggtaac cagctttagt ttctgcacat    126900
     accaaacagg acgaggacgc tctaaggtat tggcagcatt cgacggaatc gcatcatgca    126960
     aaagatcttg gcagtttgtg caattgcagc cgcgtcaata ctcgtgtcag gtaccgccca    127020
     ggcaagggtg gacgtgggaa ttggcatcgg tatccctggt gtcgttattg ctgcgccgcc    127080
     gcccccggtg tactacgaac cggcccctgt ctatgttgca ccacgccctg taatcgtggc    127140
     acccccgccc ggttattacg acgacgattg gcaagcgcgc gcctggcgcg aggaacagtg    127200
     gcgtgaacag cgatggaggg agcgtgaatg gcgagagcgc catcgcaggt ggcaccgctg    127260
     gcatgacgac gattgacgct ccggagcgct gtacttttga cgcgccggcg ctgtacttgg    127320
     atgtcaggtc gcgtgccaaa gacagtgggc gccttcagac gagatggcga tgtcgccgac    127380
     ggcgggcagg agggtccgat aaaccatggc ggtggtcccg attcgaagtc ccagggcgcc    127440
     tactccaaag ctggcgaagg tcgccgagat gacccgccac ccattttgta tatgtctgga    127500
     cgcagccagt agagggttcg agcctacatc agccgcccgg cacacggcac cacggtacgc    127560
     attcaccaag cggtagcccg cgtagacctc ctgagaatta cgcactgcat acggcgcctc    127620
     gtcaacagaa gggcctctgc ggccagccac aaggcccctc taacagagac ttactttgct    127680
     tacgtcgagt ccttgagtcc tcagcgggca gtgcttgatc cagtcgctga gccgcttgcg    127740
     ctgccggctg agctagagcc cgtgcccgac gcgctagatt gagggctcac acttccggag    127800
     ccggatagtg atccggtacc actggtgctg cccgcggccg tacagccggc caaagcgcat    127860
     acgattacta gtgcgaacgc agtcgaggtc gtctttctca tcttgtgctc cgtttattgg    127920
     gatcgggctc cacggcatcg taagcgcgcg gtgatcccgt cttgacgaca gcgccgcggt    127980
     caggactgcg ggagttgcca gtgatgaggc agaagctcct cgaggcgact tgcgggctgc    128040
     gttggcagtc gtgtgagaac gtctttgaga taggcgtagg gatcgtgacc gttcagcctg    128100
     gccgactgaa ggaggctcat ggccgcagca gcgcgacggc ctgcccgaag cgatcccgca    128160
     aagagccaat tgctccggcc gagagcaacc ggacggatct ggttttcgca ccagttatgc    128220
     cggctccccg attatgccgc gtcgtgcacg cgcatgacgg tgggtatggc ctttcatgat    128280
     cgctgtgtcg gcataaacat atgatgtctc aggctggcta atgcgctggc caggagagat    128340
     cagatgaatg caacacgcac agtcagcgaa tccggcgggc tgccggccca tcacatcgat    128400
     gcatttcttg atcgtctacg gacggcacac tattccgagg tatcgcttcg caagaaacga    128460
     agagtcctgt gcgtgttctc cgggtggatg aagaacagga acattgacct gatcgatctc    128520
     gatgagtctg tcacggctcg ttttatgaat cgcatgatcg acgcttcaag agaccgcgtc    128580
     cagcgtgcgc gtcccacctt acggcagttt cttgcctatc tgcgcgcgga agccattgtg    128640
     tgttcgccga cgttgggcgg ccagtccgag attgcgcgca tttatcgccg atacctggac    128700
     catctgaggc aggatcgtgg actcgcgaag aactcgctgc tcgtctacgg ccccttcatt    128760
     cgcgactttc tcgacagcca ctcggccaac gacggaacga tattggcaga tgcattttgc    128820
     gccgtaacga tccgagatca tttccttacc tacagcgaag gtcgatcggc ggagtacacg    128880
     cggctgatgg cagttgcgct tcgctcgttc tgccatttcc tctttctgcg cggcgatacg    128940
     gcccgagacc tgtatgagtc agtgccgtca gttcgtaagt ggcgacagtc aactgtaccg    129000
     acgttcctca cgcctgagca gcaagaagct ctcattgcgt ccgcagaccg gtcgactccg    129060
     actgggcgcc gtgactacgc aatcctgctg ttgttggcgc ggctcggtct acgtgccgga    129120
     gaaatagttg ccatgcagct cgacgacatt cactggcgtt cgggggaact cgtcgttcat    129180
     ggcaaggggc agatggtgga gcacgtcccc ctgccatcgg aggtcggagc agcaatcgct    129240
     acatatctcc gcgatggtcg cggagcaagt gcatcgcggc acgtattcct tcgtagattg    129300
     gcacctcggg ttggtctggc gggaccggcg gcgattggca agattgtttg tcaggccttc    129360
     gcacgtgcag gtttccgccc cgcgtgccgt ggttccgcac atctgttccg tcacggtctg    129420
     gcgacgacga tgattcgcca cggggcctcg atcgcagaaa tagctgaggt cttgcggcac    129480
     cgctcaccgg acagtaccgc gatctatgca aaggtcgcgt tcgaggacct gcgcggggtc    129540
     gcgcgctcgt ggcccacggc gggaggtgca atatgacttc gatccgtgac tccctcgctc    129600
     ggtacgtggc ggtccgccgc gctctcgggg catcattcta tgaacctgca ttggcactcg    129660
     gtcatttcgt tgatcttctg gaacatgaag acgcagagtt cattactacc gatctggctc    129720
     tgcgctgggc gatgacgccc gcactcgtcg aacgcgccac ctgggggcgg cgcctctctc    129780
     aagtgagagg attcgccaga tggatgaacg tcattgacgg tcgaaaccag attcctccag    129840
     caggactcct gagtgcccgc agacggcgca atgccccgca tatttacacg gagcaggaaa    129900
     ttgatctgct tatgacccgc gccgctcaac tgcgatcccg aaccggcatg cgagcactga    129960
     cctattcgac gctcatcggg cttcttgtag cgacgggcct caggccaggc gaagcgcttc    130020
     ggctcgaccg gtccgacgtt gacctcgtca gcgggatact ctccatccgg gaatcgaagt    130080
     tcggcaaatc gcgctttgtt cctgtagcag agtcgacccg ggtggcactc gaacactatg    130140
     ccaagaaacg cgatcaactc tgtccttcac gattgagcga ggcgttcctg gttagtgagc    130200
     gcggcaagcg attgaaggcc ggaactgcac gaagcatgtt cgtcagaatg tcgcgcgctg    130260
     tcggtctgcg atcggcgaca gaggatgggc gcgatggtta cggcccgcgc ctccaggact    130320
     tccggcatag cttcgcgacg ggaaggctgg tcgaatggta tcgcgccggt ctggacgtaa    130380
     gtcgagaact gccgaaactt gccgcctacc tcgggcatgt caacatcggt cttacgtact    130440
     ggtacatcga agcggttcct gagttgcttg aactcgcggc agcctatctc gacaaggact    130500
     gtccgggaga acggccgtga gcgccgccag cctcccagcc ctggttcagc gcttcttcac    130560
     ccagcgcctg ctcgagcagc aaggtctgag ttcgcatacg gtggcaagtt accgtgacac    130620
     gttccggctg ctgctggcgt tcgccactaa gcatatcggg cgcgcgccgt caaagctccg    130680
     aatcgaggac ttcgacgtgt cgttgatcga ggaattcctg cagcacctcg aacacggcag    130740
     aggcaattct gtgcgcacac gcaacacgcg gcttgccgcc gtgcatgcct tcttccggtt    130800
     cgtcgcagtc agcgagcctg cgttgtttct gcagtgtcag cgcattcttg caatcccatc    130860
     caaacgctgc gagcacggcc cagttgagtt tctgaccgag agcgaggccg ccgctctggt    130920
     aggggcgcct gacgtacgaa actggatcgg caaccgcgac cgaacgctgc ttcttgtagc    130980
     ggttcaaacg ggtctgcgca atagcgaatt gaccgcactc cggcgtcagg atgtgacgct    131040
     cggcacaggc gcccacgttc gttgccttgg caaaggcaga aagatgagat gcactccgct    131100
     gcgaccggat gtagttgccg tcctgaaaca gtggctgctg tatcaaccag gcgaaccagg    131160
     tgatccggtc ttccccagtt cgcgcggtgg tcatctcagt gccgatgctc ttcagcgact    131220
     cgtttcgcgc aacgctgaga tcgcgcgcct ctcgtgcccc tcgctgaaga agaaatcaat    131280
     aacgcctcat acgcttcggc actatatgcc cttcccgact atgtcttgta atcgaaagat    131340
     agctctctat ttcatgggca aacggatgca cggagataga gatagtcttg actccttcct    131400
     tcagccccag agcatccggg aaggagtcca tcatgagata caccatccat gaccgtgtcg    131460
     ttctcgcaca cgcaccagaa ggcccgctcg cgtcccatat cgtcgccttt gcgaactcga    131520
     tcgctgtgca gggatacagt acgcagtcac tgaagtacca cgttaggctc gttgcaggtt    131580
     ttagccgctg gcttggccga aacggaattg acttgcataa cgtctgtcct gatcacagtg    131640
     cgcaatactt acgttatcgt gcgcggcacg tgcgaccggg tccgggagac cgtgctgcgc    131700
     tcaggcatct cattgatttt ctcgatcgtg agaggctgat ttcggcgcag agaatgcctg    131760
     agcgtcggct gacccctatt gagtcctgta cacaggctta cgttgagtat ctgcatgagg    131820
     cgcgcgccct gtccaaagca acgatcgtca attacgtgcc gttcataagg gagtttctcg    131880
     aagattgctt tggtgacggg cgcatcaggc tttcgcgttt gcgtgccggc gatgtcgtga    131940
     actttgtgca atgtcaggca ctgcgtctgc atctgaagcg cgcgaagctc atgactacag    132000
     cgctgcgatc cttcctacgt tacgcgtgct atcggggcga catgacgctc gatctggccg    132060
     ccgctgttcc cgtcgtggcc aactggtcga tgcagtcaat ccctcgcggg attccaccag    132120
     agcagataca gcaactgctg gtcagtatca atcgacggac tgccgttggt cgtcgtgatt    132180
     acgccatcat cctgctgctc gcgcgcctgg gactgcgttc tggggaagtg gcatttctcg    132240
     agctcgacga tattgactgg aacacaggag ttttaagcgt gcgcggcaag agtggccagc    132300
     gtaacgggct gcctttgccc gccgatgttg gaaaggcgat tgcagcatac cttcgagacg    132360
     ggcgaccgca gagcaccagt cgccgtgtgt ttttgcgtgc aaaggcgcct gttatcggct    132420
     ttcgtggtgc gagtggcgtg ggctccatcg ttcggcactc gctccagcgc gccggcatcg    132480
     acgccccaac cacgggggcg caccagtttc gccatggact ggcctgccag atgctcagtc    132540
     acggcgcgtc actcagtgag attggtgagt tgttgggaca tcatcatccg cagaccacga    132600
     agatctacac gaaggtcgac atcaaggcat tgcgtaccct ggccgtaccg tggccgggag    132660
     gtgtgcgatg aacacgctgc ggcaggccgt tcaggagtat ctggacctca ggcggagctt    132720
     gggcttcaag cttaaagatg ccggcaaggc attgcctgat ttcgtcgcgt ttatggagag    132780
     gcaccgcgct tccttcatca cccaggcatt ggctcttatg tgggcccagc aaccttccaa    132840
     cgtccaaccc gcgcactggg cgcgacgact cagtatcgtg cgcgagtttg cacgtcatcg    132900
     tagtgcgacc gacccacgca cacagattcc tgcaccgggt ctgctgccgt tttcgccgaa    132960
     gcgggcccga ccatacctat actcgagcga tgagattcgc agactactcc atgctgcgct    133020
     tcagataccc tgccgctacg cgcgcgacga actgcaacca tggacctatt actgcctgtt    133080
     tggcttgctg agcgtttcgg gcatgcgtct gggcgaagcg cgcaatcttg agcttcagga    133140
     catcgatctg acggcggcaa tattgacgat tcgcggcgcc aaacttggca agtcccggtt    133200
     cgttccaatg catgcgtcga cctgcaaagt gctcgcggac tatattgcac gacgcaaacg    133260
     tcattgggcg gggcgacccg tgtcctccta cttgttcgtg tctaaccagg gcaatcgtct    133320
     ggatagtgga gagattcatc gacacttcta tgcattgtcc cggcagatcg gtctgcgtgg    133380
     cgcagccgac agtcacggcc cgcgtctgca tgacatgagg cacgtatttg cgacgaatac    133440
     gcttttacgc tggtaccgtt ccggacagga ccccgagcgc cgcctgccca tcctgtcagc    133500
     ttacctcggt cacgtccaca tcgcggatac gcagtggtat ctgaacgcct cgccggagct    133560
     gatgcgcgag gcgatgcgcc ggctggaaca gcgctgggag attcaaccat gactactacc    133620
     gccagtctcg ctccgttgct ggagcgtttt tttacgcaac gcctgatgca gcagcgccag    133680
     gcgagtcccc acacgatcag ttcctatcgc gacacctttc gtcagttcct gaagttcgcg    133740
     cagcaacgcc tgcaccggca gccttcacgc atgaatttcg aggaaatcga tgcccctttg    133800
     atcgttgcat ttctcgatga cctggagcag cgtcagggcg tgagcgttcg cagtcgaaat    133860
     cttcgcctca cggcaattca ttccttcttt cgttacgcgg cgctcgagac gccggctcat    133920
     tccgctcaga tccagcgggt gcttgctatc cccagcaagc gctttacccg caccctggtg    133980
     caattcctga ctcgccagga agtcgatgcc ctgcttgccg caccggacca gcgtacctgg    134040
     gccggccgac gcgatcacgc ctttttgctg gtcgccgtgc aaactggcct tcgcctgtcc    134100
     gagatgaccg gactcaaacg cgatgacctt gttctcggaa ccggtgctca cgtgcgggtg    134160
     attggcaagg gtaggaaaga gcgttgtacg cccatcgtca gatccacgct cgccgtactg    134220
     aaagcttggc tgcgggaacc ccagcgcggt gaggacgacg tgctgtttcc aagcgcgagg    134280
     ggcgaacgcc tcactgttca tggcgtgcag tatctgctaa acaagcatcg agagaccgcg    134340
     tcaaaaattt gtccatcgtt gaagcagaaa caggtcaccg ttcaccgttt gaggcatacg    134400
     atggccatgg accttctgca ggcgggcgtt gatcgttccg tgattgcact gtggctcggg    134460
     catgaatcgg tggaaaccac gcagatctat ctcgaagcga cacttgcgat gaaggagcag    134520
     gctcttgcga agacatctct ggctcacggc aagccaggac gctaccggcc ggcagacgaa    134580
     cttctcggct tcctgaatgg actgtagggc cacgaaacta tgtcgggtag tgacggggga    134640
     tggctccaca acaagtgcgc atcggacgag cacggaggca aatccctcat tacccgatat    134700
     agtcaggaag ggcatatagt gccgaagcgt atgaggcgtt attgatttct tcttcagcga    134760
     ggggcacgag aggcgcgcga tctcagcgtt gcgcgaaacg agtcgctgaa gagcatcggc    134820
     actgagatga ccaccgcgcg aactggggaa gaccggatca cctggttcgc ctggttgata    134880
     cagcagccac tgtttcagga cggcaactac atccggtcgc agcggagtgc atctcatctt    134940
     tctgcctttg ccaaggcaac gaacgtgggc gcctgtgccg agcgtcacat cctgacgccg    135000
     gagtgcggtc aattcgctat tgcgcagacc cgtttgaacc gctacaagaa gcagcgttcg    135060
     gtcgcggttg ccgatccagt ttcgtacgtc aggcgcccct accagagcgg cggcctcgct    135120
     ctcggtcaga aactcaactg ggccgtgctc gcagcgtttg gatgggattg caagaatgcg    135180
     ctgacactgc agaaacaacg caggctcgct gactgcgacg aaccggaaga aggcatgcac    135240
     ggcggcaagc cgcgtgttgc gtgtgcgcac agaattgcct ctgccgtgtt cgaggtgctg    135300
     caggaattcc tcgatcaacg acacgtcgaa gtcctcgatt cggagctttg acggcgcgcg    135360
     cccgatatgc ttagtggcga acgccagcag cagccggaac gtgtcacggt aacttgccac    135420
     cgtatgcgaa ctcagacctt gctgctcgag caggcgctgg gtgaagaagc gctgaaccag    135480
     ggctgggagg ctggcggcgc tcacggccgt tctcccggac agtccttgtc gagataggct    135540
     gccgcgagtt caagcaactc aggaaccgct tcgatgtacc agtacgtaag accgatgttg    135600
     acatgcccga ggtaggcggc aagtttcggc agttctcgac ttacgtccag accggcgcga    135660
     taccattcga ccagccttcc cgtcgcgaag ctatgccgga agtcctggag gcgcgggccg    135720
     taaccatcgc gcccatcctc tgtcgccgat cgcagaccga cagcgcgcga cattctgacg    135780
     aacatgcttc gtgcagttcc ggccttcaat cgcttgccgc gctcactaac caggaacgcc    135840
     tcgctcaatc gtgaaggaca gagttgatcg cgtttcttgg catagtgttc gagtgccacc    135900
     cgggtcgact ctgctacagg aacaaagcgc gatttgccga acttcgattc ccggatggag    135960
     agtatcccgc tgacgaggtc aacgtcggac cggtcgagcc gaagcgcttc gcctggcctg    136020
     aggcccgtcg ctacaagaag cccgatgagc gtcgaatagg tcagtgctcg catgccggtt    136080
     cgggatcgca gttgagcggc gcgggtcata agcagatcaa tttcctgctc cgtgtaaata    136140
     tgcggggcat tgcgccgtct gcgggcactc aggagtcctg ctggaggaat ctggtttcga    136200
     ccgtcaatga cgttcatcca tctggcgaat cctctcactt gagagaggcg ccgcccccag    136260
     gtggcgcgtt cgacgagtgc gggcgtcatc gcccagcgca gagccagatc ggtagtaatg    136320
     aactctgcgt cttcatgttc cagaagatca acgaaatgac cgagtgccaa tgcaggttca    136380
     tagaatgatg ccccgagagc gcggcggacc gccacgtacc gagcgaggga gtcacggatc    136440
     gaagtcatat tgcacctccc gccgtgggcc acgagcgcgc gaccccgcgc aggtcctcga    136500
     acgcgacctt tgcatagatc gcggtactgt ccggtgagcg gtgccgcaag acctcagcta    136560
     tttctgcgat cgaggccccg tggcgaatca tcgtcgtcgc cagaccgtga cggaacagat    136620
     gtgcggaacc acggcacgcg gggcggaaac ctgcacgtgc gaaggcctga caaacaatct    136680
     tgccaatcgc cgccggtccc gccagaccaa cccgaggtgc caatctacga aggaatacgt    136740
     gccgcgatgc acttgctccg cgaccatcgc ggagatatgt agcgattgct gctccgacct    136800
     ccgatggcag ggggacgtgc tccaccatct gccccttgcc atgaacgacg agttcccccg    136860
     aacgccagtg aatgtcgtcg agctgcatgg caactatttc tccggcacgt agaccgagcc    136920
     gcgccaacaa cagcaggatt gcgtagtcac ggcgcccagt cggagtcgac cggtctgcgg    136980
     acgcaatgag agcttcttgc tgctcaggcg tgaggaacgt cggtacagtt gactgtcgcc    137040
     acttacgaac tgacggcact gactcataca ggtctcgggc cgtatcgccg cgcagaaaga    137100
     ggaaatggca gaacgagcga agcgcaactg ccatcagccg cgtgtactcc gccgatcgac    137160
     cttcgctgta ggtaaggaaa tgatctcgga tcgttacggc gcaaaatgca tctgccaata    137220
     tcgttccgtc gttggccgag tggctgtcga gaaagtcgcg aatgaagggg ccgtagacga    137280
     gcagcgagtt cttcgcgagt ccacgatcct gcctcagatg gtccaggtat cggcgataaa    137340
     tgcgcgcaat ctcggactgg ccgcccaacg tcggcgaaca cacaatggct tccgcgcgca    137400
     gataggcaag aaactgccgt aaggtgggac gcgcacgctg gacgcggtct cttgaagcgt    137460
     cgatcatgcg attcataaaa cgagccgtga cagactcatc gagatcgatc aggtcaatgt    137520
     tcctgttctt catccacccg gagaacacgc acaggactct tcgtttcttg cgaagcgata    137580
     cctcggaata gtgtgccgtc cgtagacgat caagaaatgc atcgatgtga tgggccggca    137640
     gcccgccgga ttcgctgact gtgcgtgttg cattcatctg atctctcctg gccagcgcat    137700
     tagccagcct gagacatcat atgtttatgc cgacacagcg atcatgaaag gccataccca    137760
     ccgtcatgcg cgtgcacgac gcggcataat cggggagccg gcataacgcg gttcatgccg    137820
     ctagcggcat gaaccgcgtt gttcgagatc ggccaggttc cgttctcgat gtagcgcacg    137880
     agctttggcc actgcccatg caggtagtgc agcgccttgc cgaacaggct ttgcggcagt    137940
     acggtatgca ggtgttgcag cagcatcgtt tcgatctcgg ccagcagcgg ctggctttgt    138000
     tcggcgcgaa cttgctgccg ttgttccggc ctcatctcga gcgtgtggcg ttcgatggca    138060
     aacagcttgc cgatgcgctg caggaatccg gtgaccgtgt ggtcggcgcg cttgtccttg    138120
     ggcaaggctt gctccgcctc gaccaggtag cgccgcgcgt gcgcccagca tccgaggtgc    138180
     accaactgat aggtgtttgc gacgtcgtcg tatggtgcat agccgtcggt catcaacacc    138240
     gccccaggct tgatgccggc atagagagcc gtagcctgct ttgtctcgcg tgtggggcta    138300
     taggcaaaca accgtaccgg cgggcccgtg ccattcatct gcgcccatag gaagctcttt    138360
     ctctgggcag gcctgccggg ctccttgagc acctgtaccg ttgtctcatc accgtacacg    138420
     acgtctgctt ccagcagatg gtcacgcagc aggttgatga ttggctgcac cgcttggcct    138480
     actcgcacta tgcttgcggc cagggtgccg cgagagaggt ccccgccgaa gcgatgcagc    138540
     agcgctgcct ggcggtacag cggcaggcca tcctgatact tcgaggtgat gcaccaggcc    138600
     agcgccgatt cggtaaggag tcccttggga ataatgcgtg ccggtgccgg cgtcgtcttg    138660
     atgccgccgt cgcagcatgg gcaggcgtac ttgacccgct ggtgctggat cacgcggacc    138720
     tgttgcggca cgatgtcgag ctgttcgctg acctcaacgc caatctcgac cagagtctgg    138780
     ccatcgaggg ggcagacgcg ttccgattcg ggtagttcgt gacgaacctc gacacggggc    138840
     agcgccgggt cgagcggctt acggccacgc ttcttgcgtg tgtgcccggc cacttcggtc    138900
     tcgggcgtac cttcttcttc ctgcgccggc tgcgcggccg ctgccgccat ggcttcggcc    138960
     tcattgagga acaagtcctt ctgctccgag cctcgcgcct cgctcttggc ggcgaacagc    139020
     ttacgctgga acgccttgag ctgttccaag agcaggtctc gctggaccgt catcacacgc    139080
     agctcgccct tgattgcctc gcgttccgcg agtattgcct tgagctcgcg ctcggcgtct    139140
     cgcaacagtt gcagctcggc ggcggtaacg gtgacgggcg tggatggcat ggcgggttag    139200
     accgctgccg ccaagcagcg ttcacgcagc gcgatggtat tctcggtgcg ggtgccggcg    139260
     catcgcctcg atgtcaattc cctcgagcag ccagtgcaac tgttcgaccg tcagcgtggc    139320
     caccgacgcc tcgcgtggcc aagcaaaccg gtccgcctcc aatcgcttca acagtagcca    139380
     gaagccgttg tgatcccagc cgagaatctt gatgcgatcg gcccgctggt tgcggaacac    139440
     aaatacagca gatgcaaacg gatccagccc gagcgcctgc tcgaccagca gtgccagacc    139500
     gttgatgttc ttacggaagt ccacagcgtc gcgatgcagg tacacccgca gcccagcgtc    139560
     gaggcgaaac atcaatggcc tccattcagg gcttcgatca ttgcccttag gggtaatcgt    139620
     ccttttcttg cagattgata cggttatcaa tcagcccaga gtcccttgtt ggcgtggcgt    139680
     tgcagcccat tcgttgacct tattgcggcc atccgagcac ttgtcgtaca gttttgaccc    139740
     gaacgacacc ccgaaaagtg tagatgtcgg catttgcgta tcgctacgtt ggcagggaag    139800
     agttgcctgc ccgcttgaca gaatttgacc tacggcagtt ttttcagctc accagtgctg    139860
     acatcgcggc aatacgggag cggtttcggg ccgacagata cgccgcggtc ggcctacaac    139920
     tcgtttgcct ccgggccttc ggtcggccgt tggaccggtt tgctgccgtt ccgcgaaatc    139980
     tccttcagta cgtgtgcgaa actttttccg tgccgctgtt gtcgattgcc agtctgaaga    140040
     cgctgtacca acgacgcccg acgttgtacg agcatcagca atgggtcaag gagcaccttg    140100
     gcatcaagcc gttcgatgac accagccagg ccgctttgct ggaaatgctc cgcgtgcaag    140160
     ctgccgcagc ggcagacgtg gatgagcttg tcaccaccgc tcagcgatgg ctctacgatc    140220
     gctgccgcct cattcccggc cagcgccaga tcaccgacat ggcacggcat gcattttccg    140280
     cctacgaggc gcaaatgctc gcagcggtta accgcgcagt gccggcggcc acgctgcagc    140340
     actgcatgga atccgtccgc agtccacggg ctgacggctc tgcaacgcac ctcgagtgga    140400
     tcaaggcgcc gtccaggcgc aacggcccca agaacctcgc tgaaacgctg gacaagatcc    140460
     gctacctgaa gtccctcgct gtgcacgagt ggaatctgga tgacatcgct ttgcccaaac    140520
     tgcgtgccta tgcgcagaag gtgcaagcaa ggcgtccggc caagaccaaa gcactgaagg    140580
     agagcaccca ggcgcttgaa ctggtgtgct ttctacggat gagtttgctg gaactcaccg    140640
     atatcgcgat gcaccagact agccgacgca gccaggatct gttccgacgc gcggccagca    140700
     cggcgcagtc gacgcacacc cgctccgccg tggaagacag gcagcaggcg ctcaaggcca    140760
     aggccgtcct gcaagacaag agcaagtcga ccgagcagcg agtggatgaa gccctgaagc    140820
     accttgccgt cgtcaccgac gcggcgcatt cgagctttgc gtcacacgtg cgcgcggcgc    140880
     tgaccggtga ccatcagcgg attcacgctc tgctgtcggg cctggaaggc ctggaattcg    140940
     gcggcaggga ggacgatccc ggctttgcga acctcaaggc atggcgcgac ctgcagacaa    141000
     ggaagctcaa tgctctgcca gaagacttta ccgaaagcgg cgttggcacg gcgtggcatg    141060
     acctcgtcca tgatcctgac ccaaagcgcg gctatcaggc cttctctgcc tgcacgatga    141120
     tgtcgctacg aaatagcctg cgtcggggca gcgtatggat tgaccactcg atgcgctttc    141180
     gtgatcgcga ccaaatgctc atccctgcca aggagtggga gcgcgaccgt gtcaagtatc    141240
     tcgggctatt gggcctgcca gccgcggctg atacctacat cgaacagcta ctggatacgc    141300
     ttcgtgctgg cgtggctgct gtggccgagg ccaccgctaa cggcaagatc gaaataggag    141360
     acgatggcat gcttcacctg ccggcgattg tgccgctgga gcaggacgat gaaccgcgcc    141420
     gcacacgcga cttgatctac aagacaatcg gcgatgtgca attgccggac ctattgctgg    141480
     aggtcgacgc ctcgaccaat ttcagcgagg tgctgctcgg gcaccgggcg aagtccgtgc    141540
     ccgaactgct gtcgacctac gcggcgttgc tcgcccatgg caccgagatc gatgccaagg    141600
     gcattgctgc gatgattccc ggcatcgaca ccgcccaggt gtcacttgcc atgcgagggc    141660
     tggagaccca tggccgtttg cgccgggcca acgaggtggt ggctgaattt caaggaaaga    141720
     tcccattagc cacgaactgg ggcaccgggc agaaggcatc ggccgacatg atgtcgctgg    141780
     acgtttcacg acatctgtgg atcgctcgtg ttgatccacg tcgacgcacc tacgcgaccg    141840
     gcatctacac ccacgtgctc gataagtggg gcatcgtcta tgaccaaccg attgtcttga    141900
     acgagcgtca ggctggggtg gccatcgagg gcgtagagca gcacaaccgc tgcgaggacc    141960
     gtatccgcct gtcgttactg gcagtggaca cgcacggcta cacgaacgcc gcgatggcct    142020
     gggcaaaggg cttgagtttc gatctatgcc cgcggctgcg cgatctgtcg gagcgcaaac    142080
     tgtatctgcc tgcagagttt aaagtgccag aagggatcga gcgtgtcacc acgaagcgct    142140
     tgtccttgag agccatacgc ctgggttggg acgatttcct acgggtgctg gcatcgatcc    142200
     gtatcggccg cattagcgct gagctcgcca tgcaacggtt gggcagcgct gcccggacca    142260
     acagggcaca caaagctgcc gagcatctcg gccggctgtt gcgtagcatc ttcctgtgcg    142320
     actacgtgac cattgaagac ttccgccgcg aaatccatac gttgctcagc cgaggggagt    142380
     cggtgcacca gttgcagcgc gcgatccatg ctggccgggt gccacacgaa cgcggccggc    142440
     gaggcgatga gatgacggcg atctcggggg cgcacgcgct tctgaccaac atcgttctgg    142500
     cgtggaatac ccaccgcatg aacgatgtcg tcgagcgact tcgcaagggc ggcacgaaca    142560
     tcgaggacgc ttggctgcgc cgcatggggc cggggcattc cgggcacatc aacttccggg    142620
     ggatcctcag cttcggtgtc gagcgctaca ttgacgcgct gatccgaggc agtggcgcaa    142680
     caacccgacg ggctatggca taactgccat cgaacgccgc agagcaaaat ctgccacaga    142740
     ttggcacacc gcagtggctc gaggccgaaa tacggcagta ccttcgcagc ggcagctacg    142800
     acagcagctt cgcaggccgg ccaggcatac tggcgagaca gtgcctgcca accgcgtacc    142860
     aatccgcaaa gaaaggacgg tgcagcgcga aacgaagaac cgctaagtca ttgttctaga    142920
     acgtcttttt aagcctgacc gtatcaatct gctgcaaaag gacgattacc ccacgatgag    142980
     caggcgcgca aaacggtcat caacctgcgc gaccagttca acagcttcca ggacacggcg    143040
     acccagcgaa ttgagcagaa cagccgcacc acgctcgacc tgcagaacca gctcgaaggt    143100
     ctacgccagg aactggcgcg gctacgcggc cagaacgaag tgctgcagaa cacggtggcg    143160
     acgctgcaga agcagcagaa ggactactac gccgatctgg atgcgcgcct gaagaaattc    143220
     gagccgcagc acgcttcggt cgaagaccgc caaggcacgt cgcagccggg cgagaagccc    143280
     gaatacgatg ccgcgctcaa gcatttccag gcgggcgact tcaagagcgc cgggaatgcg    143340
     ttctcgtcgt ttatcaagaa gtatccgcag agcccgtacc tgccgctggc ccagtactgg    143400
     ctcggcaact cgctctacgc gcagcgcgac tataaggggt ccacctgggt gctgcacaaa    143460
     atgatcgatg ccaacccgag gcatcccaaa gtgccggacg ccatgatcgc ggtggccaat    143520
     aatcagctcg agtccggcca gaaggctgcc gggcgcgaaa cgctggaaca ggtggtggcc    143580
     aagtatcccg gtaccgaagg cgcgcgtgcg gcggacaacc ggttgaagac gctgaagtga    143640
     gcggggcggc ttccagcaag ccgcaccacg cgccgaaggc ctgctttagg tggattttca    143700
     gattcttacg aaccctacat tttccggagt gtggggtcta cgatgaccct gaaaaggtcc    143760
     tgccggctgg ctatacgggg ggatcgtgct ttcgctgcaa aatgatacgc ctgcgcacga    143820
     aattctcgtt tgaaatcaac aatttgcaca caacgacttt cccacgaaaa gctctgtgca    143880
     taactcgttg atacagaacg gttttcttgc tgaaaccgtg gcaatcagca ccgaaagcac    143940
     gataacccct tattgggggt acgatcgctg gtcggcggct acgcccggtt tgtggagcac    144000
     ttgatggcga cctttgacga tctgatggat gatgctgccc tgcgtggcaa gctgcttctc    144060
     gcgatgagga aggcgctcgt cgctagattc gaaaaactgg attggattga ccttggattc    144120
     gagcatgaaa ttggcattaa gcaacggatc cttcagggta gccagttcaa gagtaatgac    144180
     gactatcccg atcttgtgca tgacttgctg gtgcgcttgt atagcgagaa gcccgcggtg    144240
     ctgaaagcgc tggtgctgca tccgcgcttg cagtcggcca tcgaggccga tgtgccacag    144300
     gtggttgcgg ccgtgagcgg gacgccccat gtcactgtgg cggccgcaga cgctgagtcg    144360
     tcgagcgaga tcgtggtgcg cgcgctgcgc gacgcggaaa cactgattcg gtccggtggc    144420
     ggcgccgaga gcgctgtcga ccggctgcat accgccctgc atggctatct tcgccacgtc    144480
     tgttcggaag cgggcttgtc ttatgcggac ggtgcgacca tcggcgacct cttcaagctt    144540
     ctccgggaac ggcatccggc gtttgcgaac gacggcccgc acaagaagga ggtcgatcgc    144600
     atccggcgtg gcatgggcca gatcctcgac acgcttggga cgctgcgtaa ccatgccagc    144660
     atggcgcatc ccacagaggc gctgctggcg cgcgtggacg cggagttgac gctaaatgct    144720
     gcgcgcaccg tctttaacta tatcgcggcc acgatcgcgt gacgtcaccc ggcctgtacc    144780
     gcaccagtat gcggagccac attcgcgctg gcgcgcggtg ggtggggttg gttcaggtag    144840
     gttctgggcg ccgccatgcc cagtaaatgg ataacaattc agggaagata tgttcttggc    144900
     acttgaaaag ctgttggggg acgatgcgaa gcgcaacaag gcctttgcaa cctttgcaaa    144960
     ggtactcgaa aggcggttct cggaatcgga ctgggccagt ttcgggcacg agcacaacat    145020
     tgaggagatc tatggcaacg accatctcct gcggtcggcc cagtacggga actcggacta    145080
     taggctgtgc atcttgcgaa cgctcgaatt ccttttcgat gactacgcca aggcgctcaa    145140
     ggcgttgctg accgatgcgt cgttgcacaa cacgctcaaa cgagaggacc cggatctcta    145200
     cgccattgtg acggatgaag aggtcccgca tgtccccgcg aagaagccac gccgttcgaa    145260
     gctggaggtg gtcaggaagg ctttgcatga tgcggagacg ctgctcgcat ccggtggccc    145320
     cacgagtgcc gtggatcggg tgcatacggc gctccacggc tacctcaggg aggtctgcga    145380
     caaggccaag ctctcgtacg gggcgcagcc gacagtgacc gagctctaca agctgatccg    145440
     cacggagcac ccggctttcg atgcaaaggg cacccatgcc gaggcgatca agaaggttgc    145500
     taacggtatg gccagtacgc tcgatgggct gaatacgttg cgcaatcagg ccagcgtcgc    145560
     gcatccgaac gaagatctgc tggacgatgt cgatgcggga cttgccgtga atgccgcgcg    145620
     cactgtattc aactacgtgg ccggtaaggt cggcgactga agagccttct agtgtgcaaa    145680
     aaagccggcg gggcagggga tctcggcgcg cggtgcgagt ccagccgtgg ccggctgggg    145740
     tgggttgggg ttggttgctg gttggttggg aatgccggcg agtggtcccg gaaggcattt    145800
     ttgagggacc gtggaaggtg aggggaagcg agatggatct cgtgagcgag agtccgtctg    145860
     gcgagggggc gacctgacgg cgcgccgggc aattgggcgc gtggcgcgcc gtgggttagg    145920
     ttggtgtggc tggttgagac accacgctcg tccagcgtat ttacggcttc aggaatagcg    145980
     agatcggcac gcatggagat acagaccatt agcacgcaag acggcgtcac gcggatcgat    146040
     cgacgcgatt ccgagccgag gatccgtttt tcaccgttcc atggcgatac caatgccgag    146100
     gcgtccgagc ggcgtgcggc tgccatcttc ggcccggtgg agatttgtga cccgtggacg    146160
     agtgcgccgc cgtcgccgga gcagatcgcc cgcattgtgg tccttcatgg cgtctatcgg    146220
     cctcccaaga cgtttcttcc gtcctcgcca ttccagctcg tgccatccga gtttttgcgg    146280
     gtcgccaagc agcggccacc ccggcagccg ggggcgtccg cctccgcgtt tgcgcaatgg    146340
     atctactcgc tctacgccag tagcgagggc agtgacgatg accgcgagag cggtctggcg    146400
     gcggagcccg agattctcgc tttccggcat cgcgccttgc gccttgttga tgccgactat    146460
     ctgcaccagc agcacgcggc gtgggaactc gcgcattgtg gcctgcacca cggcgctgac    146520
     acgatggtgt cttacttcca tctcgatgac ctgcgggtca acggggaacc gttgcgcgcg    146580
     tcccccgatc tcgtgtatcg ccacaagacg accggtgagg tgatcgtggt ggagatcaaa    146640
     atgtcgagga tggccattcc gagcaacctg tggcccaacg tctggggcca gctgtggtgc    146700
     tacgcgcagc tgccggtggt gcgcgcagcc agtcgggtga ccgtcgtcgg cgaagtatgg    146760
     gcggagcgat ccgagcattc gcgcgggcag ggtgacgatt ggcagcgttt gccgccgtat    146820
     ctctacctgc gggcctctgt gcgccgcgat ccgcgcgagg cggtctacga tcgcttcttc    146880
     cgggcgctct ttgacattta tcgaggcgct ggcggcgggc gatgatctcg cgcctttatc    146940
     ggcgatgggg cggccactga caattcaggg atggggaatc ggcacgaatg gagacaccaa    147000
     tcactatttc gcgtggtggg cttacgcgga cctaggggtc atcgtacctt tggtgcgaaa    147060
     tctggtgctt ggaagctgga aagctgcttg ccgcaaggct ttccagatta cttcgcgccg    147120
     cccgtgagga tcgaactcaa gatcccttga ccccaccgcc cacgggtggg acgcgttcat    147180
     ttcaattcgt ccttctcgag cagattgata cgttgttgct ccaaaaacgc ttgtgattca    147240
     agagcttgca gaagaagcaa tttctcaagc gaagcgaacc ggaaagcctt gctggaagca    147300
     gcttcccatg gaccgttaca ttttgcacgt ttcgaacgtt tacccctgat gcggggacgt    147360
     ctctggtgat caccgccgcg caacaccgcc caaccgatgc tcccgttctc cgcacagtgt    147420
     agcgacgccc ttatgcgatc atgtgccctt taccgtcagt cccccatttg tcaatgactc    147480
     gcttgcgcaa aatcgagatc cgccactttc gcggcatcca gcatttcacc tggtggccgg    147540
     gccctggcct caacgcgttg atcggacctg gtgacgcggg caagtcgagc attcttgacg    147600
     ccatcgatct gtgcctgggc gcgcggcgca ccgcgcaatt cggcgaccat gattttttcc    147660
     gcatgaatgt cgaccaaccc atcgtgatcg agattaccgt gggcgagctc gacgacgcgc    147720
     tcaagaactt tgaggcgtat ggcctgtact tgcgcggctt ccgggcggag gacggcgccg    147780
     tgctcgagga gcctgacgcg cactgcgaga cggtgctgac gattcgactg acggtccaaa    147840
     gcgacttgga gccgcaatgg cagttgattt ccgagcgcgc tgcggcgcag gggctgaccc    147900
     ggcacctggc ctgggccgac cggcttcgga tcgcgcctgg ctggctcggc gcaagtggtg    147960
     atcagaacct gagctggcgc cgcggctcgg tgctgaaccg gctttccgac gaaagagcgg    148020
     atgcgtcggc ggcgttggtg cgcgccggac gcgacgcgcg cctgcgcttc ggtgatgagg    148080
     ctcagaatca attggggcaa gcgctgcagc aggtgctggc cactgccacc gagctcggtg    148140
     tgccagtcgg tggcgaggtc aaggcgttgc tggatgccca cgccatttcg gtgacgggcg    148200
     gcgcgattgc gctgcacgac gccgcaggcg tgccgctgag atccctaggg ctcggctcgg    148260
     gccgattgct ggtggccgga ctgcaacggg ccgccgcaat ggagacctca gtggtgctag    148320
     tcgacgagat tgagaccgga ctagagccgc atcgaatcta caggttgctc gttaccctgg    148380
     gggccaagga accggcaccg ccgctacagg tgtttctgac cacccattcg cccgtggtgg    148440
     tgcgcgaact ctcgggcgcg caactctacg tgctgaggca acgcgatggc gtgcatgtcg    148500
     cgcattgctg cggaaccagc gacgacgtgc agggcacgat gcgccgacac ccggaagcgc    148560
     tgctgggaaa aagcgtcatg gtgtgcgaag gcgcaagcga agttggcctg gtgcgcggac    148620
     tggaccagta ttggtctggc tcgccttcca tctcgacgtt cggcgtggtc ctggtcgacg    148680
     gctctggatc gtccgccgtg caacgcgcca tggcgttcca agcgctcggc taccgggtgg    148740
     cgctcttgcg ggacagtgat gtgccgccca aggtggacga ggtgagtttc aaggcggccg    148800
     ggggagaggt atttgcttgg cgtcagccga atgcgctgga agacgagctg tttcaatccc    148860
     tggccatcga atctgtcacc cagctttggc aactggccaa agagaagaag ggggaggatc    148920
     tggttgacgc gcacctccgg tcagcgagcg ggaacaaact cactttgccc gaaatcgaga    148980
     agcagctgta tgtggatagg gtgatcacta atgaagcgcg gctcgctctc ggccaggcct    149040
     cacgcaatag caagaatccc tggtttaaga gcgttacggc catggaggaa gttggcttca    149100
     caattgtcgg gccagggttc gagagcgctg agcccgcctt tggcactgag gtggctaaac    149160
     tgttccagtg gtgtcaccac catggctaat tatgaccttg accttcttga actagccggc    149220
     gcgcgggtag aagcgccggc cggttgcggc aagacgcaga tgctgacgaa tgccctaatg    149280
     cgtcacgggc aatccaagcc gatcttgttg ctcacccaca ccaacgcggg cgtggccgcg    149340
     ctgcgcaaac gtcttgagca tgctcgggtg gacccgagcc gataccggct cgggactgtg    149400
     gatggctggg cgatgaagct ggtcgcgacg ttcccggcgc gcgcgggcat cgacccggcg    149460
     ctccttgccg ccctacggcc cgactacaac gccatccgcg aggccgcggc acggctgctg    149520
     gcgggaggtc acgtgggcga cgtgctggcg tcgagctacg cgcgcctctg ggtcgatgaa    149580
     taccaggatt gctcggtccg ccagcacgcc attattcagg cggcttcggc atttctgcca    149640
     acctgtgttg tcggggatcc gttgcaggca atcttcggtt tcggcggcga tccgctggca    149700
     tcgtggcagg acgacgtgtg tcgacatttc ccgaggctct tcacgctcga tcgaccttgg    149760
     cgctggatca atgccggtgc agaggtcctc ggtcagtggc ttttgcaggc gcgccaggtc    149820
     ttgctgaatc ggcagccgat caacttggcg agcgcgcccc ccgccgtgca atgggtgcag    149880
     ctcgatggtt cggctgggga tcacgctcgc cttctccagg cagctggcac cgcggcgccg    149940
     catcgggacg gcacggtact cgttatcggc gacagtacca gtcctcagag ccagcaacgg    150000
     atggcaagtc ttgtgccggg agccgtcacg gtcgaagccg tggacttgcg cgacttggtt    150060
     gacttcgcga ccggtttgca gctggcagct ccggaggcgc tcaggcgcgt cgtcgaattc    150120
     tgcggccggc tgatgaccgg ggtcggcgtt gccgcactgc tggagcgagt ggaaatcctg    150180
     cggcgcggca cagcacggcg agaaccgagc ctggccgaag ccgccgcgct agcgttcgaa    150240
     gccgaacgct cgctacccgc cgtcaagcgg ctcattgagg cagttcgcca gcagccgggg    150300
     acacgagtct ttcgccctat tgtgctgcgc gcctgcttga ctgcgctcga cacctctagt    150360
     acaggcggca cgacgctgca ggaagccgcg attcggattc gcgagcaggg ccgcatgcaa    150420
     gcgagagcgc tgccacggcg ggcggtgggt agcacgctgt tgctaaaagg actggaggca    150480
     cacgtcgcgg tcgttctcgc tgcggacacc ttgaacgcgt caaaccttta tgtcgccctg    150540
     acgcggggct cgacccaact ggtggtgtgc tcacgcactc cgcaactgct gggacgttga    150600
     cctctcggga aaggacgtgg cggccgtaga atcgcggatt cctttgcctg caatgccaat    150660
     aaaaaagccc tgcaacagca gggttttttt attgagcaag cgcatctacc aatcgtcagc    150720
     gacgtgcgcc ggcgtagacg ctgaagggac cgtgttcggc ttcccacttg cgagcgatct    150780
     cggcacgctt tttcaacgcc tccacgctca tttccggacg ggcgaacaga gcgcgcacgc    150840
     gcgcgacggc ggccgaatca gcctcgttcg gacgtcgaac ctttgcaaca agtcgaggag    150900
     cgtttgcctt gcgatccatg gtgccgttcc aatgtgttgc cgaaaagtgc ttcggcatta    150960
     tctcggaatg tacatccgta tgccctcgat tctaccgggt tttcgccggc cgtgccatca    151020
     tgctcaccga ccgaccgacc agcttggcgg tgcggtagcc gtgctgttca taataaggca    151080
     caacttgtgc gagtggctta tcaatcacta tctgcgccga gttgaagtag gccgcgatga    151140
     catcaaggat aacgtcgatg gccacaaagc cacggccctt taggaagtcg tcggtcttgt    151200
     ctcgctccag gaagagtagc ttggtcagca ggccgccctt ggaaacccgg atcagactaa    151260
     gaatgcaaac gatatcgcga gttcgaatgc cgataaagca actttttgtc gccgagctgc    151320
     attttttccg cgcgccctcc caatttagca tcggctggct cgcccaccct cgcacgactt    151380
     ctggcacggc cgacgtatga ataatttctg cccgcgcggc agggtcctcg aacagagcat    151440
     gtagcgcttc ttccacctcg tccagcgcct gttgtacctg ttcaatgaac ctcttgcggg    151500
     cctcagatcg tgctgacata agtctccaaa gttagccgcc gcttcgaagc gcggtgccgt    151560
     cgggaatgga ttctaacgaa ggaagtgggg cggctcgtga cgaataagca acagctcgct    151620
     acgttggaaa ttgcgggctt ttttcgtcaa cttcagctcg cacgctgcaa gcacagagcg    151680
     aagagcagga caaagaacag ggtacgctcc tccctcaacc cggatgacgg caaccgtggc    151740
     aacgacggca agtgacaaag agcgggcgga cgcgatccgc ttgatccaga cctagatgga    151800
     cgaacgctga acgagttgga ggcgggcggg gtgctttgat ccgccgccac ccgcccctcc    151860
     gccgccggtc tgctaccgca accccagggc atgagctggg acgggcaggg cgagatgccc    151920
     gattggctgc ggcgggcggt caatgccggg cagagcgtgg aatttttcct gggccgagag    151980
     ttgcaaccgg ctctccaact taaggagtca gatttctggc tgaggccgct cccgcgcaac    152040
     ggggatacaa tatgttggga gaatgaagaa tcccatcact acatatggta taaatgcgag    152100
     atgtgcggac tttgcttggg actgaccctg agtgcagatt tcacacgcgt gccgccttaa    152160
     gcgaggaaca gtgtctctgc cggaccttcc ctttccatac ggtaagcttc aattccgacc    152220
     aatcacccgc gtgagcgaag cttcgcgtgt tgtactggtg gggcaagtct gttctcctgt    152280
     ctcactcgcg cgctttaatg cgcacgtaaa gctgcttccg gagaaggaat tcattgcgga    152340
     gtccgcgtgc gcgtggctgg ccagacaggt gggactgccc gcgcccgaag cgatgtggat    152400
     ctgcgtatgc cggagcgcct atccagccgc gtggccgtat ggggacgagg acgtgcacgt    152460
     ctgtttcggc acccggtcca taagtaatgc gctaccgctt aaagttgagt cttccaccgc    152520
     cggctggctc ttccagcaag atcgggtcct gctcatcgca aagatcgcgc ttttcgatga    152580
     gttagttggc aacgacgaca ggcatcaagg caacctcttg ctaggaccaa ctggcaacat    152640
     tctagtgatt gaccatgagc gagcccttgg tggaaccgct gctgggctct tctccagtga    152700
     cctgataggt cctaatcatc ttttggagct tgtcagggag ctgcctgcga agcaaagggc    152760
     ggagcttaaa gcgccacttc tgcagtttgc gaccgcttgc gccgttgcgg ttgatcggct    152820
     accgttcgac cagatcgccg aagccaatcc gacgcttaaa gaggcggcca aacgattctt    152880
     agcaaagcgc gccgcgtccc tgcacgacgt agtgcttcgg actctcggcg taccgggtct    152940
     accaggtatt tctgaagtcc ccctccgatc cgcaccgcta tgaaccacct tgtgttgcac    153000
     ttcgaactga atacacctgc atcaggcgtg gtcagcggcc aggctcggct cgccaatctt    153060
     gttttcgagg cttccggtga ggcgttggcc atcgcggtgc tcggccaata ctctgattgc    153120
     accccattcg cgcgagtggt gacgccgaaa attcttaagt gcctgcccca ggaactaggt    153180
     catgcatgtc ataccttcgg aaccctactg gttgctgact acctatcttg gtccaactcg    153240
     ggtaaagagt tcgccgactg gcgcgctccg ctaggtggta tccgtttggg agagcctttt    153300
     gacattgatg ctgaagacga agagggagtg gtcgtcagag ctcttgatcg ctgctctttg    153360
     tatagaggac gcgtcgactt ggcatcgaga gccgaggaaa ctgaccctag gcctatacat    153420
     gaagcgcgct tcgccaaatc ggtgaaggat gaggtcttgt ccgtggcgcc cactcttgca    153480
     cagggattca acagaagctt cagcctaact gggacgacat ccggcttctc catagactat    153540
     gtcggccacg cttacgctac ttgctacgct gccattaatc cgaaggctaa atccatggta    153600
     agaaacaaga cggcagcggc tgctctctgg cggcttgcgc gcgcacgtga cgcttttgga    153660
     tttgctacgc cggaatccat tgagttgacg gcttggatac cggcgcctgg gcaacccatt    153720
     tactcagaca gcgagtatgc ggaagtcagc gatattctct atgaactgag agaacaggct    153780
     aagcgagagg atcttcaagt cttttccgct tacgatgcaa agcgtgcttg tagccgattg    153840
     cttgcagagg aagccttgac acattaaagc gttgccttct gctagcagca gtttcatgta    153900
     agaagcaact tcgttcgcaa gctaatgttt tttttgggtt ggatagccgg ccgcgcacgg    153960
     ctgacggagc gccgacatcg aactggcaac ctgtgcatcg acttgctgct cgtccactag    154020
     gccgaggacc tttgcgccta ggtgctattt ttgacgcatg cgcggcacga agcgatgtgt    154080
     gattttggta attttcggac ggaaggaata tggccggtca tcccaatgtc cccgagcgag    154140
     cccatgttgg tgtcgagctg agattgacgt catgggctgg ttggctcaag cgcgaccacc    154200
     gcgccacatg ttcgaagctg gcgagcgcag tagcggcgct cgccgactaa tactatgagg    154260
     tcgtcaactt ggtacgccag aagtccagaa cacgatgagc caattccaca acttcaatct    154320
     ttccgcttag ggtcaggccg ttgtcctcaa caagcagcac gtagacctcc tgctcgaagt    154380
     accctggctc gacgtatccg tcctccgcat agctctcgtc cacaacatcc tcaataaggt    154440
     cgtggcgtgc attggttaat tcaaaatgtt ttaggccatc tgcaatgtgg gcgcagattt    154500
     taagtacagg gtttcctgac cgctcactga ccaaccctgc ccagtcggcg atatggtgag    154560
     ctgtgacaaa gaagttgaaa gcaatccaag cgtcctgtgg attggcctct agtttcgcga    154620
     ggtcattttc tgccttgagc aaaagatcac gagcactccg aagtgccaag aaacctgtcc    154680
     gagaaggggt gtagtgagcg atgacgtttg gcttgaccat tcgttttcct attatggtgt    154740
     gcgagtcctt tgtggggtag tcgtactttt tgagcaaaat ctggcactag ccaaccggag    154800
     agccgactgc agcaaggctt tgtggctaca ctcactttgt aacggcaggc gttgtggcaa    154860
     gcccttgatc cacattgatt tttggagcca accgccagat ttcgcaccaa aagtacgatc    154920
     accccccaac gagctgcgcg cctctttctt ttgtccatcc gcagttcgtg atctcgagcg    154980
     ctttttcctc aatccgcagt ggggctcccc cgtcaatgag aatatcggcg gcggcacact    155040
     aacctatcgc gctgtgcaag accctcgcgc accggagcgg acattctggc gcttcactat    155100
     ctacggtatc gtcatgggac atgcgcctgg gcgaccgggc gtgcgggcgg atgcgatcta    155160
     tggcgtctca aatcctccgc gagaatgaga gtgctggcgc cggggcaggt gcaagccaat    155220
     cgcggccaaa attcagccga ctagccgatc aggggcgcaa tggaaacaat cgacggtatc    155280
     gatttgagcg gcttcacgcc tgcggtcacc atcaagagtc tccacaacac ccgttgcacc    155340
     cacgtaccca ccgcagcggg cgtctatgtc gttgtccgca cagaatctac cgccccgaag    155400
     tttctctcag agagccgggc tggatggttc aaggggcagc atcccagcta tccggaacac    155460
     attgttcgag ataattgggt agaaggcgcc acggtgatct acgtcgggaa ggcctgcggg    155520
     cgcaacggtc ttcgccagcg agtgcgccaa ctggtggagt tcgcctacgg caaagcgatt    155580
     gggcatcgcg gtggtcgact gctttggcac ctcgcggagt gggaggattt gcaaatgcac    155640
     tggatggagt gcccaagctt ggcagcagat ggcctcgaaa ccgagttgat cggacagttc    155700
     cgacagatgt atggcgatcg cccgtttgcg aacatgacga agtgatagtc agacatccgc    155760
     tacggttccg tgtgccttct aattaggaac tgttggcggc gctatgctgt tgaaatggca    155820
     caaggcgacc tggattgata ccgcgaacgg cgtgatctca aagtcacggt agagccagcc    155880
     gcggatcgat cagcgcggcg gcgaaaggcg cagctgcgct tcgtcgtagg ccttatgcgc    155940
     ctccggccag gatagagggt tggccgggat tcccaaaata tctgaagctt cagatatttc    156000
     gaatcccggc cggccctcgc ggtcgcgcgg gaagaggtcg cggccatctc ggcgcagttg    156060
     gccgaggcgc gccagtcgca cggcgccgtg caggcggacc tggccgcgga gcggcaggcg    156120
     cacgcggcga cgcaggcccg gctcgaagcg ggccgcacgg aactggaggc gggccgacgt    156180
     cagctggaga cgttgcgcac ccaattctcg acggagttgg agcccgcgag caggtgaccc    156240
     tcgcgcagga acgggccgag gccagcgagc ggcggagctt gcgcgagctg gacgccgagc    156300
     gcaccgcccg ccagcagagc gagcgcgcgg ccgaagcgtt gcgcggcgaa ctggcggcgg    156360
     tgcgcagcga ggcccgcgac gtggccgtgg cgcaggccga aatccgcgcg cggctcgaag    156420
     cccaggccgc ggcgctagcc gatcggctcg ccaccgccga gcaggcgcag cgcaaagcgg    156480
     cgcacgacct ggacgcgctg caggcggagc tgggcgcggc gcagcgccgg gccgaacggg    156540
     ccgaggccga agcggcgctg gcgcgccagc tgctggcaga attgcgggtg gcgccagccg    156600
     ggcgggggga aggtggtggc gggcggcggc gcaaggccgg cgacccggcg ccgaccgagc    156660
     aggcggcgcc aggcgaaaaa cagaacgaac agcaggacga caagcagggc gcgccagccg    156720
     cagccttgaa tccggaagac ggcagcgaca gcagtgacga cagcaatgac agcaaaaact    156780
     gagcgggcgg cggcgatccg ctggatccgg gcggagatgg ccgactacgg gctgaccatg    156840
     gaggagctgg cagcggcggg gtgcttcgat ccgccgcctc ctccgccacc gccgccaccc    156900
     gcaccagcgc cggtggtctg ctaccgcaac gccgcggggc agagttggga cgggcagggc    156960
     gacatgcccg actggctcag gcgggcggtc aatgcggggc aggccgtgga gtttttccgg    157020
     gtcgggtagc gccgccgcta tctcggctcg gccgcggatc gatctgcggc cgatgcccct    157080
     tgtgatagcg gattccccgt atcttggcac gccccctaca acccgcgatc gatcgcggct    157140
     gtcgggctat tggcggccta ccgtgccgac cctcagccga caacactgga acgcgtgctt    157200
     cacgtggccg tccagcacga tacgggcatg gccgggtgct acgggccggg gcgactgcgc    157260
     agcgtaagcg agtcgccagc accgtctgta ccgttcagta gagtggcgcc aaagtagttc    157320
     ccaccaaata gtgatgggaa ctactttgtc acagtcacag gaagaaccag tcgccggcag    157380
     tcgcaaaggc cggccgaacc acagcgagga attcaagcgg cggttggcag ccgctgcgtg    157440
     tgagccgggt gtctcggtat cgaaattggc gcgcgagcac ggcatcaacg cgaacatgct    157500
     gttcacctgg cgccgacgct atcgaatgga gcagcgccag gaagccgcgg tgttgttgcc    157560
     ggtgaccgtt gaacacccaa gctcgccacc cggtccgatg ccaatgagtc cggccgctgc    157620
     ggtttgcgag ccgacgccgc cgcacggcgc cattgagatc cgtttgggcc gagcggtgat    157680
     tcgcattgaa ggggcagtcg acgcgaccac gttgcgtacc gtactggacc gtttgacgcc    157740
     atgatcgggt tgccggcggg aacacgcatc tggatcgctg caggcgtgac cgacatgcgc    157800
     tgcggattca acgggctcgc cgcgaaggtg gaggcgactc tgcaggagag cccgttctcc    157860
     ggccatgtct tcgtcttccg cggcaggcgc ggcaacgtca tcaaggtgtt gtggtcaacg    157920
     ggcgatgggc tttgcttgct ctcgaagcgc ctggagcgcg gacgtttcgt ctggccgcag    157980
     gccgacagcg gcaagatcca cctgacgcaa gcgcagttgt cgatgctgct ggaggggatc    158040
     aactggaagc agcccgagcg cacctggccg ccactgtcgg tgttgtaaac cttgcggcat    158100
     gtgcgtaaac tgccgcgcat gccaatcgac cccagcgatc tccccgacga cattgaggcc    158160
     ctgaaggcct tggtgttggc acagcgggaa tcgatcgcac tcatggaacg ggccttggcg    158220
     gtccgctcca tggagatcga gcagctaaat ctgcagatct caaagctgag gcggatgcag    158280
     tttggccaga agtccgagaa gctggatcga cagattgaac agctcgagac ccgactggaa    158340
     gatctgctgg ccgaggaagg tgcggccgaa accgaagccg atccgcaggc tacccctcct    158400
     gtccggaaga aagcggtacg caagccgttg ccggagcacc tggagcggga ggagcgcatt    158460
     ctcgagcccg agaccgaagc ctgtccagag tgcggcggta agctcaagcc gctgggcgag    158520
     gacatctcgg agcaactcga tattatcagc agttcattca gggtgattcg gcaagtgcgg    158580
     cgcaagaagg cctgcgcctg ttgtgattgc atcgtgcagg ctgcagcgcc aagccggcca    158640
     attgagcgtg gcattgccac ggcggggctg cacgctcaca tactggttgc caaatatgct    158700
     gatcatcaac cgctgtaccg tcaagccgcg atctatgccc ggcagggcgt ggagctggac    158760
     cgcacgacca tggctcgcgg tgtcggcgct tgcggtgcgc tggtacgccc cctagtcgag    158820
     gctttgcacc gatacgtgat gatgcccggc aaggtgcatg cggacgacac accgctgccg    158880
     gtacttgcgc caggtaaggg acagaccaag acgggaagac tatgggctta cgtgcgggac    158940
     gatcgcgcat cgggttcaga tgctgcacct gcagtctggt tcgcctacac accaaatcgc    159000
     cagggccaac atccccaagc gcatctggcc ggcttccgcg gcatcctgca ggcagacgcg    159060
     tatgcgggct tcaacgctgt ttttaccgat ggcagtgtgc gcgaagcagc ttgtatggcc    159120
     cacgcgcgcc gtaaggtgca cgatctgcat gtccgcaagg caacgccgac caccacggag    159180
     gcgttacgcc ggatcggcga gctctatgcc atcgaagcgg aaatccgggg taagccacct    159240
     gccgtgcgtc aacaggtgcg gcagcaaaga tcccggcccc tactggacag cctcgaagtg    159300
     tggttgcgag agcggctatt gacgctctca acgcagtcgg aaacgaccaa agccatcaac    159360
     tacatgctga accagtggca agcgctaatc tactactgtg atgatggtct ggcagagata    159420
     gacaacaaca tcgcggagaa tgcgctgcgc ggtgtcgcgt tgggtcggaa gaatttttta    159480
     ttcgccggcg ctgacagtgg cggcgagcgc gcggccgcaa tgtactcgct catcgggtcc    159540
     tgcaaactca acggcatcga tcccgaggcc tatctgcgtc acgtcttggc ccgcatcgcc    159600
     gatcatcccg tcaatcggat cgacggactt ctgccgtgga acgtcgccgc tcaactggcg    159660
     ttgcaagcct aaagcagcac cattcctgtc tcgtcgtcaa ccacggtgct ggcgatccgc    159720
     ttactgcgca gcgatccctg ccaccggcaa tgctacggac gctgatgcgc ctgggcctga    159780
     cctcgaccac ctacgccttg ccaagccgcg atctagtgga ttgggagtgc gtcgaggact    159840
     atcgcgccca tcgtgaggcg caagaaaacg cccgaaaaga cgcggaacgt gacaggctgc    159900
     gggcagcggt cacggcggaa ctgcgatggc tgtcgggcga gggggacgag cctggctggc    159960
     cggagctgcc ggacccgaga tccccgaagg tgcgtgccgg gatccccttg ggcgtgccgc    160020
     gacgacagcg tgcaaagcca cccgcgccac gcgagtacgc gctggactcg agcgcggcgg    160080
     cgcattggct gtcgctcgcg aaagaccttt ggtatcggga cgcgcccgag cggttgcgcg    160140
     gcctggtgct tcactgttgg gcgtggacgg caagcgcgaa cggcgtcgga tgcaaaaaag    160200
     atgaagagcc tggggagcgc gcgcatcaat ggaacgaagc gtatttcgcc gcagcgaccg    160260
     ccgcggccgc cacgctgggt gatgccggcc tcagcgagat ggtcctccag cgcgtcgccc    160320
     agttgccgca agatcgcttc ctcgacgcca ccaccgcggt gctgcatgag ctcgacagac    160380
     tctggatgaa caacgggctc gtgtcgggtc ccttagtgtt attggtatgg gagaccctgg    160440
     cgtcgcgcat cagggaattc tgggcgtgga agcgactcac gtctgagtgc tcgaccagcg    160500
     cggaaatcca tctcacaggc gcactcgctg cgctgtttat gggggagtac gagatcggga    160560
     agggacctcg ctgctatgtc cgtccgcccg gggctgaggg agcggacgcc ctgttgccga    160620
     tgctcacgcg cctggccgtg gaggccgcgc cgtccacctt cgtcgccctc gcgatacttg    160680
     gcctgcttga ggtgcagccg caagtgcatc gactgacgtt ccttgcggga gtggtcagtg    160740
     cctggtggcg ggcgcagggt gcaaacacgg aattctggaa cgactacggc atagggcccc    160800
     gggtatgcgc ctgggtcgaa aaggccatcc taagcgctcc ggtaccccag gaggttctgg    160860
     atagcgcgga actgacgtcc gtcgtggata cgctggtcca aaccggcacg ccactggcgc    160920
     ggatcctcga cgagaagctt gcgcgaccgc gctgacgcgg tcctgtggat caagtcccac    160980
     atggcccacc tcggattgac ctacgagcag cacctcctcg cggccggctg tttcgcgtcg    161040
     cccggcgtgg ccggcggcaa aaaggtgtcg gtggagcgcc tgtcagagga gttccgggat    161100
     tcaccgccaa accgcggcga agcatagcga gcgcctggcg ttattcctgc ggggtagaaa    161160
     gggtgttaat ggcgaaatcg gcgagcaggc aaaggcaatg cagtatgtgg atgctgcgta    161220
     atcgtggcat tgttggaatg gaagaggctg cgtagctggt cggtgacttt ggaggataat    161280
     ggcctttttc gctcctagtt tttgactagc atggacgcgc ctaaagacga gccagtactg    161340
     ccgcagccca taggcacaag ccccgaccag tggaaagctc taggaagttc cattgttgag    161400
     atcggggttg ccattggatc cgccttcagg cagatgcagg agtggtgggt agccaatgct    161460
     ccggttatag gagctgcaat tcagttcgcg attaaggagc ttcctcctgc gtaccgtcga    161520
     gcaatggttg aattggctaa gcacggttgg tacattgata tgcagcgcat ggggctgggg    161580
     catccccctc ggctagccga agctcttcgc aagaacgagg gtgccgagga ggcgaaggaa    161640
     gagctaagac tgcatttttc agtgcatttg gatgagattg aaactgaggt gtgcgagctg    161700
     ctcccacacc gctcgcatat cctggcgcag gcgttcaatg cccacagggc cgggcagtac    161760
     gcgctttcaa taccagtgtt cctgtcgcaa gccgatggaa tctgttttga aaaggtgaat    161820
     gcctactact tcgtttccga caagactccg gagggtcgga agattggtcg cccggagact    161880
     gctatccatg ccgaatccct cgaccatgat ttttggacgc gtattgtgct ggctccgcta    161940
     ggcgaattcg gtgagctcaa tgtaagtggc aagaagcggc ctccagactt ccaagggcta    162000
     aaccgccaca cagtgatgca tggtcagtcg ctcgactatg gaactgagat caacagcctc    162060
     aaggcgatct cacttctgaa ctatgtgtcg cacgtcttgg cccgcaagag ctttccgcag    162120
     cgtttgcagg aaggtgacag cccgccagtc gccggccgcc tcgtgcgaaa tccacgtcgc    162180
     taacccggag ctgctcgtca agttcgagcc gggccagagg tttttacgtc gacttcacac    162240
     cccgcataac cggggtagtc ccgcgtagcg cgcattcctc ccgggaaagc cgagggttcg    162300
     cttgccgagc gagagttata gaaggaagtc gaccgggaca gccccgtgaa ggcaaagctg    162360
     aggcgacgcg cgcccccgac gcacgcacgc cgcaacgtcg ctacgtcgct ggatgtgtaa    162420
     ccgtcttacc gttacatcac gcgggccctg gtgaaggcac tgggcctgcc ggcaggaacc    162480
     attgaattcg agctgcgcgc tgccgtcggc gagatcgtta cggtgaattg cacttacgtt    162540
     caaaccaatg acactacttt cgggtttaag ccggcgccgc gcccatgcgg ccatccagtt    162600
     ccatcatcag attctaaaac tgagccgtgc cggtcgcctt gaacagcagg tcgcgtgtgc    162660
     gtctcggtat cccgtccatc ggtaccgact tttttgttct gggcgtggcg gtacgtgttc    162720
     gcgaattgcc aataaggtgg agctcgccgc agcgcagcgc cgggccgagc ggggcgaagc    162780
     ggaagcggcc caagtggacg actttagcga gacgtcagtt tcccaaaaaa gctgcgaatc    162840
     ctgcgcgcag gtagatgctg cttcgcgcgc cgtcgtccgc gatgccgcgc gccaagcctc    162900
     gcatctgagc gagtagcagc tccctcaacg cccatagatc ggctgaacca ggagcggcat    162960
     tggcaacgtc ttcgatgagt tgtcgcacgt aattcttggt ttcatcatct acttcggaac    163020
     tggtgaggca ccttagcaga cagatcacaa acagagtctc attttgaaag tgtcgaacta    163080
     cccttgagcc taacacgagc gacttgggga acccttcagg atttatgtac gcgggcgtcc    163140
     ttgttcttgc ctgttgcact gcgctcgcac atgcgaagag caactggata ggcgtggcgc    163200
     cggcgaccag caatggcgag tcattgccaa agacgggcgc cgaccgcccc ttttccaggc    163260
     atacccactc agagtggacc aggcctgtct ccgtttgccc caaaagtgcg cctcgctcat    163320
     ccgtcccacc tgcctcctcg tcgtcaaact ccaaggggag ctgagaaatg ctgaaggact    163380
     ctcggcacca cggacaagcg cgctcgccgg aatccggaag tgcaaaccga tatagccatt    163440
     caacacgaaa cgccctttca tgatggtcgg aggcgatgcc tcgaattgca ctgtccatct    163500
     cactttcatt cgcggggagg acgagcagtg gcatgagtgt gatgagcctg ggcgccacga    163560
     agaggtcgtt cgatccccgt atggctttga catatgcctg caatctttcg gagccgtagg    163620
     cgacgtcatc gattatcaat atcgattcag actgcgagat tgcttccgcg agagtgcgat    163680
     ctaggtcgac cgcaagattg atgcgcaatg attcatgcga ctctacgcga atctgtagtt    163740
     cgcgcttgag gaatcgggct attgcagccg cgcctcgatg aacaggggtg atgatgaggt    163800
     cgggaactgg gtccataccc cgaatcttgc cgaggagctg ttcgcaaaat gctgggattt    163860
     ccagcagttt ctccacgttg atgctaaatg cacgatgctt cccgcttccc cagctcgtat    163920
     cattgacgtg cgtgcgcaaa acgccatcga aatggccgta agcttcgatg aaggtgcgct    163980
     gcgctctgaa gaggaggggg ggcaatgccc gggtgtcgac atttctcgcc gcgaggaagt    164040
     atcgagcgcg atcaatgcga aatacgggac tgttgccttg ctgacatgcc acgcaatgtt    164100
     cagatgacgt cgtgtgccag tagtcatcga tttgtagtgc gcaaaatgca tgcgacgctg    164160
     ggtctggcgt ggttgcgtag agcactgacg taccaacggg cacatcaagt gaccccgcga    164220
     ctctccgcaa tgtcttagtg agtgtgccag tggacgacac gctgacaatg aagtgaatcc    164280
     gggagtttac cgcaatgcgt ggctgcagcc attgacgaag atctgccgat ctgtctgggt    164340
     tctcaggata tgcgcgtacg caatcatatg tcatcgccaa tttggggaag acatgactca    164400
     agcgaagcgc aagagtaagc gtactgggat tgtcgaccag cacaactaag ccacaagtct    164460
     gattcggatc agcaccgatg gcgtgttgtt cacagatgtc tcgggcgacc caatatacga    164520
     gtttatccag atcgtcagta cttgctaagc actcggcaag tcggaagaaa tgagatgtgt    164580
     gcgcgcctga tggcaactca aaatggcctc cgtccaccgc cagtaccgca cgatttcggt    164640
     gaacatttac gatgtcagag agttcctggc tgcggatatc agtaagttcc tccgccatca    164700
     tcacagctag ggcgggacca ccgtccccgt cggcggtcac catcaagggt gtcttgagca    164760
     tgtcttcagg agacgcatcc gagacgatct cgttcagctg aggcaagcgg ggcaggatcg    164820
     ccaagcgtcc acctttcaag cgcttcgcaa cgtctgccaa agcgtatctt agacgaccgg    164880
     acgctgtctc taccgtctcg gcaataaccg cttgattgaa aatcgcagtg gctgtcaaca    164940
     aacttcggaa taggggcaag gcaacacgag cgacgtatgc tccagcctca cttgcataat    165000
     catgcgtagt ggaagagaga gcagcgtcga tatcggcgat ggactctatg tcgccgcgaa    165060
     taaacgccca gcgggtatct gtcattgccg ccttagagag ccagtacgcg ctgatcgacg    165120
     tctgtgaaga gcacaggcac aaacaggtct acgcatgttc ctgccgcgaa ctgctgagga    165180
     agcctggaga gaaccgcgcc atccattgtc ggcatcttgt cttctccgag ggaaaagtct    165240
     ttgataagcc gatggccagc ggaagtaact tgcaggcgtg tccgaagacg aaatgccgcg    165300
     tccacgacct taagcaagcc catccctttt tcgacggaac tgacgctctt gcgggtctgc    165360
     ttcagctgaa acgccctgcg caaccgatct tcggggtgtt cctcaacgga ctcagcaggg    165420
     agggtgttct gaatgccttc tcccatgtcc ataacggata tgcaagccag cagtcggtct    165480
     ttgtccgtct tttccatttc cgcaacgcgc agcagaaatt cgcgcatctc cgcagaaata    165540
     tctcgcctgt ctagctgggc ggcgttgaag acgatcttgg taatcgagat gcctcgtgtg    165600
     ctatgccttg ctacgcgagc gtcgtgtggc cgtccgtgct gtagcgtgtt cgcaaaggtc    165660
     tcatagatga aatccgtcag tgttggaaga gtgctttggc tagcaatgcg ccccaagccc    165720
     atccctgaca aaattctgtg cagaccagaa gcgaactgcg agggcaatgg tatctcggtg    165780
     gcgttgacat ccgagtgggt gtcaaatacg cgaggaatcg agcgtttggg atcaaacgcc    165840
     aggatgccaa cgcggtctcc gagtccaatt acgccacgct ttgcatcgta gcagcggcca    165900
     gcaaaccgtc gaagctccgt cgcaccactc tcagggccgt cacggaacgc cgcggtagca    165960
     catgcccgta agagcgcata gccgaacatc gtggacagaa gcgttccact gaaatcgttg    166020
     ttgtcccgag ggaaagcgaa ttcgcaatgg atgtgtaacg aagagcatct cttgatggca    166080
     gcactaaggt acgccagggc aagcccctct gcgccagctt cgaactccgc ggatttgcca    166140
     ataacaaggc taagggaggc ttcgcccgcg tctggccatt gcaaaacatc ttctgcggca    166200
     atgcgatcaa gcagcgtgac ttgggtaggc atgcagttgt tccgaggagt tcaaagccaa    166260
     caaatccgtg ggttcgggat cttagcgcac tgtagcccgt tcagcgagca gtggaaggtc    166320
     gggcagacaa actcgggacg tacgatcctt ttgaatcaaa gacttgcagc gaacgcctag    166380
     ttttagcttt cccatgaaaa aggtcatcaa agcacatttt aggtgtcgat gggaattgtt    166440
     gacctgctgt tctccgaccg ccaacaagct ctacagcctg gtgcgcaagg gcagcgtggc    166500
     acgccagctg agccgctgca agcgtactcg caggagctgt gcgggcgcac gcgcgtcacc    166560
     atcgagcatc cggacctccc ggacgctttg aaacaggtgg ccgcccacgc ccatcaaggc    166620
     aatctgacag acggccaccg aagccgccat cggcgagctg gccacgctgc gtgccgaggc    166680
     cgccatgtgg tcagtgccgc caagggccgg cgaacgaatt gctgataagt ctttgaatct    166740
     tcggagaatg atgtgggctt aacttgtgat ggcggtctct caggtgactc ccactcgctc    166800
     cacaagctgc ttgccccccc acgattgtgc tatctggcct ggcccgctct gggtgagcgc    166860
     tggcgtggct ggcggcttca aaaccagatt cgctttgaat gctgtcaaaa tacggacaac    166920
     gaaacgccgt ggagcagcaa tgcagggttt accggtctcg ccctcgctca ttcctctcga    166980
     caccctgagg gaacagatcg cacgggccgt tgccacggcc aaggcctacg acgttcccga    167040
     tgtctgtgtc ggcctgagga ttcagcagtc ggtggacgag gccgatgcgc aggaggcttt    167100
     cggcagcaaa cggctgtacg tccgacgcag gatcatctcc tggagcgagg cggacctttt    167160
     agacttggca acgcgggtgc tacgcgatta cccctcggag gaacttgcgg acatcgtgag    167220
     cgagatgacc gtccatgcag aacagcgcgt aagtgcattg gtccggcgtg acgttctcaa    167280
     ggctctcaat cccttggcct ccctgttcgg cgacctaccg ctgattgatg gactcagagt    167340
     ggtgttcggt gcctcggtca tccaggacga tccgacaggg ctgactggtc tgcttggcct    167400
     taccagcctg catgggcaga ttgtccagca ctgcttacgc aacgatgact ggtcccatga    167460
     agagctgctg attcaatgcg gcgcgatgac gtgcagccag acccgcttct tttcgttgct    167520
     gaacaagctt ttgcatccca tgtcacgccg tgacggcgag caggcgacac tagccaccgc    167580
     gatcgacacg gcactcaggc gggacggctt cgcggttagg aagaccagcg tggagtcggg    167640
     gtacgccgtc tatggcgtgg tccgcatgca ggcaggtgtc gtcggagcaa tgaagaacct    167700
     gatcttcgca tcaatcggtg agaagccaga attggtcttt cgcgacgcag tcaataacga    167760
     cgtcgagatc atcaagcatg ccgacaaagt actggtcttt gaccgccctt tacccaattc    167820
     cggactgctg ctctggaagg acttgcgcga ctggtatgcc gaacttcagg gtattagcga    167880
     cgtggccagt gcgaaagaga atcttttccg gcggctgcgc caggctgtgc tcggtgcccg    167940
     ttcggcgggt gagtttgcgg tatttcaagg ctactacgag cgctacggtg gtccgcttgg    168000
     agagcggttg cccgcgcttg tcccgcaggt ctatctgcac tacgacccct acacccgtcg    168060
     ccaacgcggc gacgaacagt ttttagcgcg ccagcgtatg gattttctgc tgatgctgga    168120
     tcacggcgtg cgcatcgtga tcgagatcga tggccgccac cactacgcag taccggatcc    168180
     tctagcgccg gatcggttca tcgcaaactc ccagcgctat gccgagatgg tggcggaaga    168240
     tcgtcggctg cggcttatgg ggtacgaggt ctaccgcttc ggcggttacg aattcttgga    168300
     cgttgacctg gaacagcgca gggttggtcc acacgctcaa aaatgcgtcg cggacttctt    168360
     tgacaggctt ttggcccggc attgtgttag gtgattagca ttgtgtgagg cgacatacca    168420
     tttgaagaga ccaactacac aagcgctggc aatggcagat ccccgcatga ttttttagtt    168480
     cagtgagcga gagaacgggc gacgtgctag gaccgggtat gcgatattgc cgacggtgtg    168540
     acgaggtacc ccgcggacgg tcctgctcgg agtctaacag ccaggcaaga ggcggggaac    168600
     cgtttttcgg ccggcctgcc ggccgcactc gggtggcgaa tgtcgaagca gggtcccgat    168660
     tgtgaaggat cctgcgcggt aaacgtggcg acaagggacg cccggtttgc cgccaaggct    168720
     gagcactctt tgacgaagac cattacgtct cgtcgtcgag gccttcgcga tccttcgaaa    168780
     gctccctcag cttcttcccc atatcggtgg ctatcatctg ataggtcata ttcgcattca    168840
     ggcggaccaa ctcgtcgacg ctaagcatgt cgattcgacc attgggcagc agtcggacgt    168900
     tcaacatacc ctccatgcca ttgggatgca tcttgccgga ttgaagatgt tcgtggacga    168960
     gattgattcg ttcctcgaac tcttccctcg tcgtgggccg ctgcattgtc gtgagtttgg    169020
     gcaacatgat ctattacgcc ttatgaagca ccgctcggac ctgtccgttg atcctcaaca    169080
     tccattgcat gcgccacccc gcaggtaggg ttaacgcgtc gcgacggatg gcgagtatgg    169140
     aaacctcatg acgacggctg actccccgag ttcggacagt gctaccgtct ctccaatggt    169200
     acctgaccat agcggaaggt ggagcacgca atagatccac gaattgcggg ttcgctatgg    169260
     caggtgtgag agctccaaag tgtgccagtc caggtttaac acgaccgcag actgtaagct    169320
     ggtcgcttgg cccaggtcgc ggaagctccg tcggtttaaa ggtgcctaac tgcccggagt    169380
     taggctcccg ctgtcccggc gggagcaggt gcgatgtaag gtctacctta atcacctgcc    169440
     gccttcgctc cagatagcac tggacatcca agaaaacgag atcgtcgctt gagggtagga    169500
     accttgtttc gttgcctgac tccattgcgt cgatcagccc tgcgacgagc cgccttccgt    169560
     ccggtggctc gaccaacgac tccgggttgt aaatgcgcag agcagcttca atcttggcga    169620
     gctgctcaat cgacgctggc gcgaagagtg caacattgag tgcaaaccga actcttgctg    169680
     cccatcggtc cgggacgacg cctgcccact ctccatgcct tctagcagcc aggctgtcga    169740
     gttgttgcac atcggataag gcgtatggtc cgcacgagtc ctgaaggatc gacgcagctc    169800
     gctgtagagc cgcatcgttc aagatgccca agcgcgtaag ctccctccaa gatgcagtta    169860
     ggctgggagg cacgtggtct gcatgcaggc ggctcttcgc cgggtcttct gggcttggat    169920
     gcgcgattgg cttggcgcgt agaactttga ccgcatctgc cgctgaagca acgcccttat    169980
     tgctcgcgcg gtcggctatt cgcaggagcg tcgcaaaccg tcctgcatgt gtgcatgccc    170040
     gcaccacttc gttgacatcg acgaagcgca cgacacgttc ccaaaggctt gctggagtct    170100
     cgcgggacaa gatgtccagc gcccctgcag caacgtcagc gcggctgcca ctatccatcg    170160
     aaaacgccag ccgggccagc ctcgccatca aagcatcgtc agagcgcagc aaccagagca    170220
     ccattgctgc agctgtatcg cgccgctccc agctcgggtg atcaagtgcc caaagcaaga    170280
     gctcaaggag ggcatcggat gcactgacgg gctttgttgc tccgatgtat gagaaggctt    170340
     cggacggagc gctccccacc atctcgcgaa catgctcagt cgcgaccgac agtagctggg    170400
     tccgctgact tgcatctagc ttggggccaa tcaaattgat gaggtgatac gcggctgtcc    170460
     agcgctgcac gtgctgctca ttgagagcca gtgggccgta cagtcgcgct agctcatcag    170520
     ccgactgcac gttctcccgg atgatcgtgt cagctaggct gctgcccgag tggcccttct    170580
     cccatatcga ccacccgccg ccttgtaatg ccctgagagc gaagacagct cgctcaacgg    170640
     cagctgatgt gtttcggcgc ttgatgtgtt tcctcgcttc ctccagcgct aggtcagcat    170700
     ccctgacgga agttctgctt ccaaaggtgc caggcatgaa cagccggtcc tcgccgccgt    170760
     cctcctcatc agtctcggca gcttctgcgg catttgggac gtcgggattc ggcgggccgc    170820
     ctgcaaccac ttcactgcga acaccgaatc tcgcagttaa ctggtcaaac tgattcgggc    170880
     tgaaagactc tcgaaactgc tgaagcatct ccgagaacgc ctcgcaaagg aaggccggca    170940
     gcgcccccgt caagctatgc atgagcatcc aagcgcgctc ggcattcatc gtgtgcgcga    171000
     ttctgccaat tcgcttgact gcccaagcca ggtccgccgc gctgtgtgat atttcctgga    171060
     tgatggtcgc gtaggctggc ccccaatctc tcaggtaccg ctcgtctccg tgctggtaga    171120
     cctctaggag cgcccagcgc actctccagt ccgcgtggat tccagcgtgt tcaaggagct    171180
     gcatcaatgc cgcttgttcc tccagcgcgc cgcctgggta acgcatgcca acgagaggag    171240
     ctacgcggtc aagaccaccg tccgatgctt gttcgcacat ctccttgatg ctgccatgag    171300
     cctgatgctg aaagtagcga acggcgtctg catacatgcc acgtcgactc agttccccga    171360
     tgaacgtccc cttgtctgag cggacgtatc gctgaaacgt catctctccg ctggcgtgtt    171420
     ccaggtacgc ggcaatctgg gctaaagccg cgggggcaat ctcagcgtct gctgggagtg    171480
     cttcaagcac tctcgacatt acggcgaatt ggtcctcctt gtaccaactc gggcccatcg    171540
     aagcggcgag gacggagtga taggtacgga gagcttcctc tgcggactcc atccgagcga    171600
     acagtgggac catcgagagc agttcaggta cgagctcgtg cctgttctgc acgttgtctc    171660
     tgacgtagtc ccgccaacgc agcaagagcg cgaacgcttt atcggcggta tcgcctgaaa    171720
     tgcctgcatt gacgagcgtt ccgatcaccg ctgccaaggc gcgacgaaag ccttcattgt    171780
     acaggccgag ttgtccgtca aatgactcct gaataacctc gagaagctcg gcagcctcgt    171840
     cgggaagaca gtccagatag aggtctgcaa ggtggccgta taggagcggc agaatgttct    171900
     cagggatgaa gtaggccccg gcccaaagca tgcgcgacgc gagttcgagc ctgaagaatg    171960
     ggagaacctc atcgttgagg tacttctttg cagaggcgag ggcggccggg tcactggttg    172020
     cgcgcgcatg gcgaactttt gcgtctgccc atgcaacggc ttgagccagg gtctctagcc    172080
     attcctccca gttgccgtgc tccagcgcct cgggcatggg tctggtctgg ttacggccca    172140
     gaaaattggc ggctcgaaga cgcgcgtagg cctccacgaa cgccttctcg tcggcgagag    172200
     agcgattctc tgtaaacaga ggaagggtag cggcatccca caccactccg ttggagtagg    172260
     cctcaacgag gccggcgtcg gctcctgctt cgatcagcaa gtcaacgacg ccaaatgcct    172320
     tctcgtcaac ggttagcgag tcgtcaatct tgctgccaat gtccgcgagc agcatctcca    172380
     ccttgtccct cggaaggcgg gtgccgtagt tgcgagcgtg gatgcgagca taggcaagca    172440
     ccgagattag cgagagcgct tgatccttgt tgggcgtatc tgtagggata ggaagctgag    172500
     agagcggctt gtaggaatga gccacgcaga ggatgtttcc gagcatgttg ccgataacgt    172560
     cgctcagcag cttctgcccg tgctcctgcg agatattgtt ttggggtgct ttgacgagcc    172620
     gaatgacgta tttcaggaag tcgaatgtgg acggatcggc tcctgcatag ctagccaagc    172680
     catagccttg gagcttgact gccgctgcat tgagatattc gccaaccttt acgccgtcgc    172740
     gtgtaaggat cggtagaagc aggctgtcga ccttttgaag gatctcgagg gcttcgttct    172800
     gatgccccgc ctcgatgagg cttcttgcta tggcgaaggc gtcgctcggg tctacgatga    172860
     ggtgcccata gcgaaggatg tgccgcatag cctgttctgt cttgccaagc gcgatcaggg    172920
     cctcagcggc aaggccagca gactgagcaa agagcgtgtc gtaacggaat ttaagccgtt    172980
     gcgagagaag caggaggcga aagatgtcag tcgcggtgcc tagacgagtg gcagcctcaa    173040
     gcgaatcctc gatgtccccc aggagaacgt caggctcagc cccgagaagt acggattggt    173100
     cgacccattg ctgctggcac tcacctatcg ctgccagctg cttttgagcg tcggcacgga    173160
     ggccatggaa cacacggttg agcgtcccgt agtcgccgct accaggctga aggcagaact    173220
     cagcaagtcg cccttgaacc cattcgctct gcgtcgatgt cttgtgaacc acgaagtcag    173280
     agaacgacga gtgatagacc tcggtcgtgt ccggtgccga cagcaagtgg cggatgcgag    173340
     tgatggtcgg aacgaacgct gcagactctg acggggtcag catggccatc aggtcggtcg    173400
     ttgggatccc ccagcgaagg cgcgtgacga tgctaagcag gttgatcgca tccgtttccg    173460
     caaggagctg tgcccagatg ctctcgtagt agtcttcaat agatccacta aacggcggca    173520
     gtgactcgag gtcgccctcg ctggcgccac cgttaacgag gtcgacaagg tagcgcaggt    173580
     acagcggatg gccctttgcg cgctcgcaaa gagcagagac cagtgtagaa gtaaccttct    173640
     ctgcatcaag ggacgacgcg caaagccggt actgaatgtc ctcgtccaag gtcggcagcg    173700
     tcaagcgctc agccccatag aggagagggc tgagcttgcc ggcgatggcg tccagacctg    173760
     ctcccactac cacaacttgt actcctggcg gaatgcttgg aggcaagagt ccgacgaagc    173820
     gctgcaaggc gtcaccgccg acggcagcag cctcgttgat cccgtcgatg aacaacactc    173880
     ctactttgcc gtcactcgag caacgttgcg ccaaggcctg aaaggcctga tgcgtcgtct    173940
     gaatgagctg tgcatatgtg agctgcatca gccgagctgg cttgccggta gcccgcgtcg    174000
     atagcaacga ggtcaaccag tcgacgaaga cttccggttg cacctggaga gccggagtag    174060
     agccgcgact gcactcggaa aaggcataga cacccaggac ttctacattg gccgattccg    174120
     gcttgaagcc tcggcaatat gtcgacttgc cgatgccgtg agcaccatca aggaacaggt    174180
     atcctccgcc ggccttgacc actgtcgact caaacaactc atcaaacgcg ggccgcgatg    174240
     cgaacggtga ggcgtcgcct tgagacgctt cgccctccgg aagaagcccg tttgcggcca    174300
     ggaactcccg aagcgcctcc gtgctcacgg cgccgagggc gttgtcgacg ctgacgcgca    174360
     gcatcccctg gcagccgtct gtagtcatga gcgcagcgcc ggacatcccg cggtagtcag    174420
     tcaacaccgt ctccgggcta accgagaggt cgagatctac accgttggcc agctcgttca    174480
     gggcctgctg caccgctccc tgcaggacct ggccaatctg cagcttggag accggatagc    174540
     caaaggagag ccatcgctcg cctggccgcg gagcgccgac gttgagtgct actggcgcga    174600
     aggcggaggg ctcttgaagc ctcaatatgc aaacgtcaag gtcggtatca aacgcatcca    174660
     agaccgcctg ctgcttcgac gcggactgcc cgactccaaa gctgacctca aggctgactc    174720
     cttgatcggc tgcctcgccg agacagtgat aggccgtcag gacatggtca gcagatatca    174780
     gccatcctgt accggcttcg ccagcaccta gaacctggca cgtcgcgagc ttcacttcct    174840
     cttcagtcat tgttcttctc cctagacgtg gatccagccg tcttgaacga cgtccacgtt    174900
     gaacttcgcc ccggaccttg acacgtgcgc cctgaggcga gtggatgcgg gggtctcgta    174960
     gttgaagtag atctttcgct cgaaggtcgc gggcctgtcg acgatctcgg ccaacacttc    175020
     atagtctggg tgatggtgga ttgatccgtt ggttgaaacc aagaaaatgg gagcgtcaat    175080
     gagcgacaga agatccacgc tcgtgttgtg gatgctgccg tgatgagaca ccttgatggc    175140
     atcgaacagc tgcggacggc catctccatg gagcctcttg agctcaacga caacgtcctc    175200
     ggcccaagca tcgcccagaa acagtagcct cttgccttca ctctcgatga gggtggcaat    175260
     cgaactgcca ttggtagggg agatgtcggg cacgtacacc tcattgagcc tcttggtgct    175320
     cccagctgaa atggtcttga ccatcgccgg tgccggctgc cgggtgtatg cgcaaaccat    175380
     ttcgtaggcg tcctcaacca cagggtcgac cgctgctcca cctttgtagg agagcctgcg    175440
     catctccagg atccaccaag tgcgcaattc ctccagtcgg gccactgttg ggcctatcaa    175500
     gcggacctga acgccattcg gcaaggtgta cggggggcgc ccgctcgtca tgttcgtggt    175560
     gccatcgctc gcgttccata ggtagccgta ttgcttgagg cgcttcgcca aggagcttcc    175620
     ctgctttgcg ctgatgggat ttgcagtcgg cccagatgcc ggtggcagaa gaaatcctcg    175680
     cctccggatc gcctcgagta cctggcagtc ggacgcgctg tctggcgggc ctggtgggga    175740
     cggaagcgat cgaaggctgt tgtgccagac ctctttgacc tcaacaatgc ttcgcgctcc    175800
     tggagcgccg ttcgaggaga tgaactcgag aagccctcca atgtggtctc catcaatatg    175860
     ggtgcagacg agcagatcca gttggccgcc cgcacgtgcc aactgcctca aatcgggtgc    175920
     gatgtggtcg ttgaaggtgc tcgcaaagcc cgcgtcgatg aggacgtggg agcctgaagc    175980
     atcgacaaga aaggcatcgc cgtttctagc cgggtacatt ttcagtctga gcatgcacgc    176040
     tattcgctat ctcctgaacc cagccttctt cgcattggaa gcctaccgta cgcgaccttg    176100
     cgaaatctgc gttcgacaaa tcagtccgtg gcaaataaaa gtcggcccgc gcttggcggg    176160
     tcaactcgga ttcttagaag ggatattttt ctttgagatc agaatagttt gcagcgatcc    176220
     agtttattac tttggaacgt ccttggatgt cggaaggcag cttttcgtgg atcatccatt    176280
     cacagatttg acgcgtgcgg atgctcaaat cggcctgatc tttgcctttg agagaattga    176340
     gcaacgtcaa gacttcgtag ccctctttac gactgaacct atctgcgtcc tctttggtct    176400
     tcttgggatc gtccccagtc acggtggtcc agctgtagtc ttcgtagttg agatcgcttt    176460
     ttttgatttc cggcactttt ctcatcctcc aggtgaagtc gaatatcggt caggggggat    176520
     cacgatacat atttcaaggg ctactaaaaa aaataatatg cctttcgtgg gacttgccgg    176580
     attctcaact gagcacgcaa ggtaagaggg gaacccggtc atcaatattc tcctgggatg    176640
     ctgcgtcacg tcagcagttt aacgggactc gctggatttt cttgactcga ctcgaaggtg    176700
     tcctgtttta agcgacagtg atggtttgga cgcctgccgt cgccagaagg ccatacagcg    176760
     gtgcgatgtt gactcgtgca ccacgctgtg gcgtataggt aaagatcacc cgttgcttcg    176820
     cgcgtgtgaa cgccacgaag aaacctgccg tcgcgtcgac ggtgtcctgt acaaagctcc    176880
     accatgccga gtcgtcgagg ccgatgaaga tcacggtgtg gtactccagc cccttgctct    176940
     tgtgcagcgt catgagcggt agggcttttg ttccttcgta ggcatcgagt gtcgcagccc    177000
     agtcagttgc ctggacggcg ctcgactgca gatgcaaggc cagactattc tcgacttccg    177060
     cgagccaccc cccttgtcca tagggcgtat gggccgcgat gagggcatca cggcccagga    177120
     aagcctccac ctcctggatg acagcgcggg ccatcgcctc agtctccggc ggttggggat    177180
     gctgctggat aaaccgacgc gcaaaggcgt ctagatcctg agcaaggacg cgacgtgcac    177240
     ggtcgtcggt aggcgcgatg ccccgcaagt ttgctaatgc gtgctgggct tcgatccagg    177300
     tcaatccgcc tcgaggggcg caggccaagc gaaggattaa cagcactagt tccgacaggg    177360
     gttcggtgag cagctcttgc agcatctggg cgccaacata ggcggcttcg ttgcgcaggg    177420
     ggatacccgc ggtcgcaaag gcgggggcta ggacccgggc atagtcttcc gccttctgcc    177480
     gtaccaacag cacgaagtcg ttgggctgta attgatgctc gcgcatctgc gacgcgacgt    177540
     accgggcaag agcctgggct tcagtgttca cgctggagaa gtcccagatg gcacagcaag    177600
     catcggaaat actggcggcg gcttttgact gtgggtgcgc ggcagacgtg tcgagcgctt    177660
     gcgccagtac gtgttggatg cgcacgagct cgggcgagga gcggtagttg ctgagcagag    177720
     ggatgcgttg cgcgccgaaa gtctgttcga atgcgccgaa aggatcgtcc atcgctagtg    177780
     cgaagcgcat gatctgctgc ttgttgtcac ccacagctgt caggatcgtt ggcatgccca    177840
     ggaagattgt ttggactagg tcgaactggg cctcagtcgt gtcctggaac tcatccatga    177900
     acacatgaga gtaggtcagc gccaaggcgt tacgtacgga cgcattaacg cggaccagca    177960
     gttccgccag tcggctgagc atggggaagg tgaggtggct gcgcgtggcg cctcgaagct    178020
     gttcgtccca gaaccgctgt ccagcccaga ggcctgcatt tcccgacgtc cagccggcct    178080
     ctggtaagcg ctcagcgagc acatgacggc gctcgaagta attgaccgag agtccttgca    178140
     cggccgcttg cccgaagggg ttgtccagag caagggacgc acgctgcagg aagtcggccc    178200
     aatgcgcccg cttggggaac aaaatgccat agtcagccgt aggccgccaa cggtttggca    178260
     gtgcctgtcc gaaccgatcc acgaggctct tggcgaacgc atcgaaggtc agcgagtcga    178320
     agcggctcgc atggtcgggg tggcaacgct gacgcacacg gcgcgcgagg tttcgtgcgg    178380
     catcgcgctt gaagctgatg gctagaatac gctgcggagc aggggacgcg cctgtttgta    178440
     ggaggaacgc agcgcgttgc gcgagcagtt cagtcttgcc ggcgccgggt ccggcaagca    178500
     ccgagcggtg ctcggccgac cgaacgacgg tcaatgcatt cggctccagg ctgtgcacgc    178560
     cgaccggctg ccagtcgccg gggggaacgc gtcttggcgg caacgacatt gtcacaacct    178620
     tgatacctga gcagagatat gcagcagcac acgctggaga ggcgcaggca tgccggcttt    178680
     taatgcgggc aagtcaatgt gcgtgagtgc gcgcaggtgt gtggcaggct tgctgtgcgt    178740
     gaggaagtgg tagcggtatg cagccatgtg gtcacggaac atctgcgcgt tgccggtgta    178800
     actgatcagc ccgggacctg ccgttccaag cactacctcg gcagcgcttt cgttagtcat    178860
     acgcggccca gctccgtcga tcgtggctgc gtatgcagcg gggaaggcgg ccagcatcgc    178920
     caggtcaagg tcaagtggcc aagagaagaa caccgaggaa gagcgctcta ggtagctcaa    178980
     ccacccctcg agattggctg cgtcaaatgt ctccatttct gcaagccgct tatcgctgag    179040
     atgcgtccca tcggagagtt ccagaatttt ttcgcgagga acgccaagtg cgagcatttg    179100
     ctgcaaggca ttcttgagtc ggccatagcc accaccgtcg cgacccagat ctaggtcgag    179160
     cagggtcgcg taaggaatgc ccaggccatg gagcagccgc cagaaatgat taacgtggcg    179220
     gcctccgaga ggcacgatcg caacgaacga cgggtcgacg agcaggttga gcgcctccgc    179280
     cagccgcggc agcacgatac gctctgaatc gccctcaacc aacagcacaa aacgcgcaaa    179340
     gtacagttcg gggaatgcaa ggaaggcgtt gcgcacgaac ttgatggcct cgacgtcgct    179400
     ggtcggcatc gggatgggca gcaccgttga cacgccagtc gcttggttgc gccggcagta    179460
     gcgcacgtcg tcgggcggga cgcgccccag caccgagggg gaatggctgg acacgatggc    179520
     ctggccggcg cctgtctcga cgagcgtgcg gatctgctgc aggatacgcg agaggtagta    179580
     gggcgccagg tggttctcgg gctcctcgac cgcgaacaag gtgagggctg gtacgttgag    179640
     ttcctcggtc ctgaatccct ggatgcggcc cgccactgca gcccgctcca cgtcgaagac    179700
     cgcggctgcc agcgcgaagt agaagagtga ctgctggccg tcgctcagcg cgtcgagtcc    179760
     acggtcttct ccggccggtc cgcgcttgaa catcacgccg atgcgtgcga cgacttcctc    179820
     gaaccgccgg ctcatcaggc tcagttcggg gttgcagtcg atgtcaccgt cgtgcaattt    179880
     ctcccaccgc ttggatagcg actcgctgat ggcctgaatg gcgttctcgc ttccaaaggc    179940
     attcagcaac tgctctgtag ccgcgtggac ggtcgcctga gtgcccgccg accattcgat    180000
     ggccctgagc aggcgagctg ccaacgcccc cgtcgtggct cggatctgag tgccagcgtc    180060
     gcggctggcc ggtgtgtaga agagctggat cagaccgcga tctcccgggg ctaccgggga    180120
     ggcttgatcg tcacgtacga cgtcatcagc tgtgttaatc cagttcaggt cctgactgac    180180
     ggcgccttcc gcagtgccat cgtcgtccca gcgtgcgcga agccgcaggc ggcatagagg    180240
     cgtgccgccg gggcgctcga tgcggacatg gcgaaacacc ggtgcgaccg tggcagcggt    180300
     cgcgctgccg tccaccagtt ccggcaggct caggcgtaca tcgattgtca gcgtccgcga    180360
     tttgaggcgt tcggtctcgg tcggtgtgac atgaaaatcg gaggggacga tcgtgcgctg    180420
     agcgcgcgtc accccgaaaa gtcgcatcag agcctgcagc accgctgtct tacctgatgc    180480
     attcggcccc acgatcgcgg tgagtccctg gctgaagggg atggctgtcg ggttagggcc    180540
     gaagcagcgg aaaccggcta tcgtgacgct ttcaatatgc atgaaacggt gctcttcctg    180600
     gctgtttgca atttatcaga tacgtattgt ggcaaattca cgctgtatat tggtgcattt    180660
     ttttgttatg gcatcaagtc gtggcggtgc tgagaggctt gcgggtagct agcaagcccc    180720
     ctctttcgta gggattaagg cttgccgggc agatgccgat tcagaaccaa atcctcggtg    180780
     cagttatacg cgcctgagcc tccattcttt tactcgacag tgcctatagg gacccccagt    180840
     gtatctagct caagcggttg cgtgaaggcg ccttctcagt tgctcgctga gccccactcc    180900
     gacgccattc ccgtccctac cggtgacgag gagcattcga cagtcgtcgc cagagccgcc    180960
     ccgttagcaa gcatttctgg tgcttttcta gcgaaattac gcgggcttgt cacgataccc    181020
     ttgtttgcca gcaattcaat gacacttaat cccaagccga cggaaagcca gacatctcac    181080
     ttcgaaagga tcctgcgagg gatgagcttc atcaaggatt tgctagagat catactgaag    181140
     gtctcgccgc tcgcattagt agcgcctgcg atgactgttt ggctctatct tcgaaagctt    181200
     ggttggtcgg aactcttcgg tgagtcagtt gggtcactgc cgggcctgct ggcactgctc    181260
     gtcgggtcga tattaatctt gattgtattc ctcctccagg ttgtcctgcc ctcaatcttt    181320
     ttcggggcag cggcggaggt gctggacgat gagagaccaa atcctcgtct tgcgtcggcc    181380
     cgggcgcaac agcttcattt cgtgcccgtg ctgatgtggc aactttgttt cagtgtctcc    181440
     gtagcatatt ttccggacgc gatcacgtcc ccgttacagc tcgccactgc cgtttcggcg    181500
     gtaaccgcag cggcaatggc cgccaaattc cgtgaggacc ttctacccgc gtcgacgaag    181560
     cagcgtatta ccgtaatgcg acagggaggg aacacggcgt actatttggg ctactgtgct    181620
     ctgctcatgg gcgtcggtat tgcctttccc atcgtaatct ctgttgcttc ggctgcttcg    181680
     ctgctatcgc tgtggtggtt gacaaaagat ctgaatatca cctctcctgc ggcctttgtg    181740
     gttctatgct gcggggcagg agccattagc gtggttcctg gcttggccta cctcggcgcc    181800
     aaggttgaga gacatcctcc ccgtaagctt tggttgctga ctgcattggc tggcggcggt    181860
     gttctgtatg cagcgatcgc aacagccatg ttctttgcgc caatttccag gcaatccttt    181920
     gaacttgccg gcgtcagcga tacgcagcca cacgtttatc tactgcagaa tgagtcgatc    181980
     ctgccatcta taagagcagt tgggattcct acatcatcca caaaagagtt ctttcccgat    182040
     gggaaggagg ccgtatttgt tggcgcctat cttcagttca actttggtgg cgtaaagttg    182100
     ctgtgtcggt cgccgtacga cgctgtcgat cctgctgtct ctataacagc tgacgcgcaa    182160
     cgggatctcg gctcgcgctc gaacctgggc ggcggatgtt tgcccgtgag gcctgacgat    182220
     gtgcgcgttg tccggccaca tcgatagtct gctcttcgtc tacggtgaga tcgctatgtc    182280
     cgtgagatgc tcgtgggctt agctatatcc tgacctgtga ggaagagcac tgcgtccggg    182340
     tgtcgtgcta tagcatgagc ccagaccacg gattgaaggc atggaacaca tcgtaaactg    182400
     aagactaagg ggaactcagc caagcacatc gggagcagag tcgtcggttt gcataatttt    182460
     gttcccgccc gtcgcccgcc agctcgccgt ttccgaggtg ccaggaacaa ttttatgcaa    182520
     agaaattttg cagaacattg ttcctccggc cgacgttttg cgtaattttg ttcgtttccc    182580
     gggagatcgg tcagtcgctg cccagcccgc tgcagccagg gcacgcaggc ggaggctgca    182640
     agacggccgc cgcgcgccaa gccaccttcc gcggcgctcc cgtctggccc agagggccag    182700
     gaacaaaatt ctgcaacatt cgggaacaag attctgcaaa cggacggccg cggccttcag    182760
     ctttccctca ggccgcaatg acgtattgcc aaagcgccat tgcgccaacg ttcacggcga    182820
     cagtgcccca gaacgaaact tggaactccc gtttccggtt cttgtgtcga agcaggtgct    182880
     gggccgcaag cgcgcccggc caaccgccgc agagcgccag taggtgcagg gtggtctcag    182940
     gcgtgcgcca cgtgtttcgg ctggcccgcg tcttgtcgtc tgcgtaagcg gagaacgtaa    183000
     tgatgctggc caggaggctg acaatgccgg cctgtcgagg gaaataacca accagggcgc    183060
     cgccgacgat gaaccccaag gccgccagac ctgcgagcac cggcaaaggg ctcgcgtctg    183120
     accgcgactt cggtgcaccg acgattgcaa cgttcagggc ttgaatccgg ccgtccttcc    183180
     ctttgccaag ctcgaagctc acgcggtcac caggtgtcgg cgtcacggcg cgtgtttgta    183240
     gcgctgtgac gtgaaagaag acatccttca tgtccgcgta gacgtcgata aagccaaagc    183300
     ccttgtctgc atgccacgtc ttgacctgac ctgctttttt catggttttc gtctggtgtt    183360
     gcgcgaagga tccagtttaa gggatgccgt caagcgaaac tatggccgaa tccgtgaggt    183420
     caccaaggta tatgccggct gtctctcggc tctgccaccc gtagtcggtg gggtgttggc    183480
     ttgctgcaac ccgtcttgca tatcagatcg ggtagatttg ccgacggcgg gattccgcgc    183540
     caatgagatg aagaacaaca acaggtagag aaatgggtcg ccgaaggaag gagccgtcgc    183600
     ttagcgaaat attgatggat gcgccatggt gggtatccgc agcactggcc ctgggtgctt    183660
     tcattgtgtt tcgcggggtc gtgccaggga tattcgcgtc gagcccattg ttgacgggca    183720
     ttgccgtgct aagccagtca ttagcctggg ttcccgccgc catgttcggc ttcctgggtg    183780
     tgctgtcata catccgtgcg cggggtaggg cgggggccag gcagcaagaa atcccgatga    183840
     gggctcggcg ctcccgcacg agccggccgt cgtcggcccc cgtgtcaccc cggtattccg    183900
     atgaatccgc cgagtcgaag gaggccgtta gcccgctggc gaggacagca tccgtacctg    183960
     agaagccaga gatcaatagc tggacgctgg atgccctcaa gttgttagag tggaagcgat    184020
     ttgagctgct ttgtgttggg tactacgagg cgatggggtt cgtggtcaag actgtgcccc    184080
     atggtcccga tggcggcatc gatgcaacct tgtacaaggc aggcctggat gttcccgtgg    184140
     ccgtggtcca atgcaaagca tggagtaagc cggtgaaggt ggagcaggtc cgcgcacttg    184200
     ccggtgtcat gcacgaacac aaggtgcgta ggggcgtttt ctggtcgttg tctggctatg    184260
     tagggcgacc ggtaaaggag tcggcagagc gagcgggcat tcaattactt gatggtgcgg    184320
     gcatcctgga acggatctgc gcgctcgatc agtacaagca agcgacgttg ctgaagcagg    184380
     cgtttcgcgg cgactaccgg acgcctacat gcgcggcctg cggaatcaag atggttgagc    184440
     ggcaagggtc agccggcgca ttctggggtt gccaaaacta tcccggttgc aaggtcagac    184500
     tgtcccgcaa cgtctagtct aggaaccggc tcgatcaatc atcgccgccg cgctctcagt    184560
     caacaaggtc actcccgggg aaggctggct ttccggcagg ctcgagcgcc tattttctgc    184620
     cttgctactg acacgggtgc ttttaggttg cgaaatatgt ctcatgaacg gtctgcggca    184680
     tcgccagagc caggtcttca tcactggaga ggcgcagccc ggcacgccgg caaggacttc    184740
     cgtctcaatc cggtcggctc ttcccgcccc tcaagcgacc gtcgtcgctc tacaaagcag    184800
     ccggtcaggc ggcggccgtt gcacggcggc gttttatgag gcgatgaccg attcgagtcg    184860
     caagtcgctc gccgtgatcg gcgcgtcggc aggctggagt ctcagatgcc ccgacctcgg    184920
     cgcgcggctt aagccagctg cgggcgcatt cactccatag catgaagcca ggaaactgta    184980
     gcgccaacat gcgtcgccgg aacccatctg cctatcgcac gcttgacaga accggagaat    185040
     ccgaccgtat ctgcgaccga aggcactatc tgctggatcc catctgatat tggaatagca    185100
     cgttcgagta attttgagct ttctttatcg ccctcgacca ccactagctt gtcctcacgt    185160
     tgcacgcgac gaaagtgggc attgttcagg tgcgatgaga tggctggtgg ccacggaagc    185220
     tccgggctca ttgcatgaac ggcatggact acgaagtagc cgattacaca gcaagtaccg    185280
     gttgtgatgc catccccctg gaagcccgca tagaaaacaa gatagtcgcc acgattcagg    185340
     gttaatagct gggagcgctt tggatgacta ggctccccat agctgtaggt gacgaactcc    185400
     gggtcgtagt gagccggcgc atccaggcca atgacttgcg cgagggtgct gccccgtcgc    185460
     gacggaatgt cgccgtatct aagggcattg tgtactggcg ctccttcagg aataggcacg    185520
     tattcaaagc tgcgatcggc ttcaatagga gatagccgac cgccgcatcc acggtcgatt    185580
     cctacgcgca ggaagagaat tttggtttct gacattttgc tgagaaaacc tgtgtagcgc    185640
     aatgagactg tttcgtatcg atttttcctt tacccagcgc tggcgagggg ggcgcgtcat    185700
     gcgcaagatg caggatagcc ttcagttccg catacatatc ttcgaacaca ctgtcagata    185760
     tgatgacgcg tcgatttgtt ttcagcatat gcccataaag cagcgggtag tccgactgaa    185820
     gcaatggccc gtgctcgttg agcagaatga aacgctcaaa ggcccatatc gcgtgccctt    185880
     tgggactgac gccgcacgct ttcctgctta tcccaaccca attcactttc ttcgctattc    185940
     cttcgtcgcc aggccacggg cttactcctc caataccgat tacgtggttg aagctccagt    186000
     cccgtaccga tcccatgcag tcattgcatc caaagaggcc gctttcgttg gggtcacccg    186060
     tatgggttct tttgtagatg agaattcttg gtctgctctc cggcattgct ctgtctcgat    186120
     gggaggggcg cagcggtcat cgcggaaatc gctgcaatcg tggaaaacgg gcaatggaca    186180
     gattgtcgct aatctggacg tgccagtcca acgaccggtt gaatccgcgg ccggctaccg    186240
     ccgttgcgct acctccagac tcgcaaacaa gaggagcagc tgcccgcgtg gtcaggatgc    186300
     tcgtgacgcc ggtgttacca gggcgcggca ataaggttcg ataacgttgc cttatcggcg    186360
     agtaggcgcc acgaggaata cagaaccggg ggaaggaaca gctgtcgtag atgctgctta    186420
     ctgcacttta caccaagaat ttgataacta ttatcaaggg cggtacactt catgacaccg    186480
     gcgtacgccc tgcgccggcc ccgtctgaag aggagcaaat atgatcagtg ccgaccttgg    186540
     acagcaactt gagcgctacg tgactgaact tgtcgcctcg ggccgctatg gctctaagag    186600
     cgaagtactg cgcgaaggcg tacgtctgat tcaggaccgt gaagcgcaac tgatggcgct    186660
     ggacgcggcg ctcgcgcaaa gcctggccga ggcggacgcg ggccgcggca ccgacgcagc    186720
     caccgtgttc gaccgcctcg aggccaagta tcgcgccgcg gcaggcagaa cacccgggca    186780
     cggcgcatga tcgtcgttcg cctgacgccg ctggccgagg ccgaactcga agccatcgcc    186840
     gactacattg cccgcgacaa cccgcgccgc gcgctttcct tcgtgcggga gttgcgcgac    186900
     cggtgcctgt cgctcgcaga catgccgctt gccttcccgc tggtacctcg ctgtgaggac    186960
     cgaggcgtcc ggcaccgtgt acacggcaac taccagatct tctaccgcgt ggtgggcgat    187020
     ccgcctgcgc gaatcgacgt gctgcacgtg cttcacagcg cccgcaacta tgccgcgctg    187080
     ctgttcaact gaggcctccc ggccagagta cggcggtaga cattcggggc cgcgtcgctt    187140
     cggcagcccg acgacttagg tatcaaagtg gagggcggtg cgccatgatc gattctgcct    187200
     cgatcacgaa gcgccccgcg tgaacgcagc caaatttgaa catgacgccc gtactgagta    187260
     attttgccag tagcaggggg gttatgtgga atggggaggg tgagacgtcg gtcggcgcca    187320
     ccggcacctc agtcggccgt cgaagcgcag gcgctcgaaa cggcagcaaa gtcgaaatgc    187380
     gcggcggcat agatggcatt gcaagcccag acttcttcgc catccttgta gaagatgacc    187440
     catttgccgt cgctgacgca gtgggcgcca ggaaacactt cgtcatggcc attcggtccg    187500
     tccagcggaa aggacgcgtg gggtgtggcc cagtagcggc ccttcggtag gggctcgatc    187560
     gtctttggca tgctcatcag gcccagtgag gtgttacaca agacaccatc gcccagtgaa    187620
     ggcgaaacgg gggatggtgt caccctgcaa cagcgaagac cgtccttcgt gtaggcttca    187680
     ccatccaatc acctgttgct acccgttgcg atgtcgatgg cacgatacct cttgtttgtg    187740
     gcccgcgccc tcggcgtagg cgccctgatc atgatcgtcg ccatcgtctc ccggcaagta    187800
     tatttgcgca gcgctgcgga ggctgctgac gccggcgcag acgaggagtc tgcggaggct    187860
     gccgacgccg gcgcagacga ggagcctgcg acaatgatgt tgatacgctg cgagacgatg    187920
     cacgaacgtc tgcagaaccg gcacagctcg gctgcgaagg ctgacgagcg gccacgcgct    187980
     cgttgcaggg agtcctgact tcggagaact tccgattagt cgaccaggag ctaggccgca    188040
     cgcctggtag gcgacagcgg cgaatgagcc gcgcacaatc aatactttca tgatcatgaa    188100
     agtattgatt gtgacgatgg gccccgcgga cggctatgct cgtcatcgct agccgaccca    188160
     cagcggatcg tggttcaagc gcaagaaaat cggccacgtt cgggggagcc gccactcgaa    188220
     cgttccgcat aaagccgtgg gccaacgtca gtatatggcc gatctgccag gcaatctgtc    188280
     tgtcacggcg gtgcctgaat tcccagagga ccacccttta ccgccagaca ttgcggcatg    188340
     tctatccggc gctacgactc cagaatctcc agcccacttt cggcacacca ttgcctcagc    188400
     gctctttcgg ccgagtcggc ttcaaacgaa taccagagct cgagaatgcc tttgcgctcc    188460
     agcaagtcct tgaggcgcgc gtaagcgcct tgtcgccgga agaattcttc cacctggtcg    188520
     cgacactcag gcaactcctg tgcaacaaat tggagggcga gacttcgtcc aagaccgagt    188580
     tcgttcttat gcggtatcgc aaggtagcgg tccgaggttt caaggtcgtc aggaacctcc    188640
     tcgtcgaagg tgtcgttgta atcagaagtc caatagactt tgcccgtatc gagtgagaca    188700
     tacgcgttgt gctccatcgg cgccgcgcag ctaacgaagt cgaatgccat ggatagatcg    188760
     tcgtgtttga ctgcgaccat gtctgtactc ccatgggttg cgaggtgaac ggcccagcaa    188820
     tattcggtga cagccggaca tctgtcttcg tcaagggccg atgcatgatg atggtaccgc    188880
     agcgctcatc gcggcccgaa ggccgagctc catggtcatc caccgaccgc tgaaagcgca    188940
     tcgccccgca cgtactcttg ccaggacaat ttctcggaat atcacgacgg cttccatgcg    189000
     agatggaatc gaagtttagc gggacgtccc cttcaccggt cgagtactga cgcgcttcct    189060
     tgttgcagcc tcgttctgcg ttgcaggcgg ggtcgccacg tttgctttac cggcaacaac    189120
     gttgccagat gctgatttgc gtggccctgc ggatgccttg actgatgact tcttggttac    189180
     cgacttatta tcctccgcag tcttcgcatt cgcaggtggc ttacgggttg tcgagacggc    189240
     cgacttggtc gccttcttcg ctgtcacctt acctgccggt ggcttgttaa gtctgacagc    189300
     aggcttcggc ggtgggttag cgtcggccat ctcgatgcca aacacgtcgg ccaccagggc    189360
     gtcgtcgagc accttgctgg tggcgggtcg ttttgtcgat ttgggcaggc cagcgccggc    189420
     ctgcctgacg agatcattgg catcgacgcg gcgcagggcg aagagcaatt ccggctgttg    189480
     gtcgagccgc gcgccgatgc cgtaaagtac ggcagcaacg tgcttgcaca ttgacgccca    189540
     gtccggacaa ctgcaactga acctgatgtc ttccggcatc gggaaaagac cgctgcgagg    189600
     tttgcagatg cgctccatca cggctgtcga gagcttgccc tgcaagagtt ccacgatcga    189660
     atcgatcgat tccgcgcaat cggcgccgat cgctcgccat tgctttgcgg gacatgccgt    189720
     cacggtcaca gcgaccgtgt acagactcga acccattacc tgcgcgcgga cttcgcctgc    189780
     cgtaatctga aggtcgatca cggaaccgtt gcgcacatag gtacggccgc gcggcaggcg    189840
     gttggcatag tcgctgtagc tttccagatt gtcgcaccag gccttgcccc agaaggtctt    189900
     ggcgatggca ccgcggtatg aggcgattgg cgacagcacc gaaccagcct tcttcgcctt    189960
     ctcggcggct cgttcagcct tctttctgcg ctcggcgact gagacatagg gcttccatcc    190020
     cccgtaaccg taacccattc cggttcctct tgacgatcag ttttcttgcg cggcatgaac    190080
     gtcgagcttc acgagatcga gcaattcacg attgctcatc tcggtaagca ggagttctgc    190140
     gccgccttcc aacacatcct tcaccaattg ctgcttcgct tcgatcaact ggtcgatacg    190200
     gtcctcgacc gtgccacggc agataaactt atgcaccagg acgttcctcc gctggccgat    190260
     acgaaatgca cgatcagtcg cctggttttc caccgccggg ttccaccagc ggtcgtagtg    190320
     gatcacatgc gacgcggcgg tgagattcag acctgcccca ccggccttga gcgagagcac    190380
     gaagaagggg gtcagctcat cttcctggaa tcgcttgacc agttcgcggc gcttggcgac    190440
     cggggtgccg ccatgaagca ccagaccttc gcggccaaag atcgaaccta gaaaagccgc    190500
     cagcggctca gtggtctcgc ggaactgggt gaataccagc accttttcct gtttggcggc    190560
     aatgacttcg gccagttggc gcaggcgggc gaacttgcca ctgtcttccg ccttccaggc    190620
     ggcgtcgccc aaccactgcg acggatgatt gcatatctgt ttgaagcgca tcaggtagct    190680
     cagcacgaca cccttgcgac cgatgccgtc ggcatcttca agcgcggcag ccagatcctt    190740
     caccgcacgc tgatacagtg ccgcctggct cgggctcagg tggcaccagg ccttgagctc    190800
     ggtcttgtcc ggaaggtcgt cgattatccg cttgtcggtc ttcaggcggc gcaggatgta    190860
     gggccgtacg agcgttcgca gcggaccgaa gtgctcggcc ttcgccagcc gcctggtaaa    190920
     gtcggcaaag actttgtctg agcccagcaa tccggggtgg gtgaaatcga agatggacca    190980
     cagatcggac aggcggtttt ccacgggagt gccggtcagc gcgatgcgcg attgtgcctg    191040
     gagctgcttg acctgtcgcg tttgcttggc gcccggattt tttatcgcct gtgcttcgtc    191100
     gacaatggca acgcgccatt ggaaggctcc cagtaccggc tggcgaagaa gcgcgccaaa    191160
     gctggtgatg acgagatcga tgtccgcaag tcgcgccggg tccagcgcac gcaattcggc    191220
     cgtcggcatg gccgacggat gggcgatcag taggcgcaag ccgggggcaa agcgctcagc    191280
     ctctgccgcc cagttggcca gcagcgatgc aggggcgacc agcagactgg gccgcgcctc    191340
     ggcactttct cgcttcagca cgagcagaag cgagagtacc tgcatggtct tgcccaggcc    191400
     catatcatcc gccaggcaag cgcccaaacc gagccgggtg agcaggtaca accaccgcac    191460
     gccggcctgt tggtagggcc gcagggtggc cttcagttcc ggtcccgggc tgatctgcgc    191520
     caacccctct ggctgacgca actcctgcag ggtgtcagcc agccagggcc ctgcaacaag    191580
     ctgcgaccag tcgcggtcag cggggtcggc actatcgtcg agcgaaaccc ccgccagaag    191640
     gcgtagagcc tcattaagcg gcagaccgct tcgcgccgcc ttttccatgg cctcgaatcg    191700
     cttcatgaga cgactgagct ttttcttgtc cacctcgacc cagcgaccac ggatgagctg    191760
     caagccgtcg gcgcctttga gcagattcct gacctcggtg gcgctgagac actcgccatc    191820
     gagcgaaacc tccatgctaa agtccagcaa cgcgtctttg cccaagagcg agggtggccg    191880
     tgctccgaca ctggctttca caacgggacg agcagggcgg cccgcctgcc agacgcctgg    191940
     catgcgtacg acaatcccgg cagcttcgag tttggacagg tccgagagaa ggcgatgggc    192000
     atcgagcggc gtccagcgca gcggatggta tatctcgccg gtatccacca tttcgcgaag    192060
     ccagtcgcag tgttccgcgg cgcgctgcac cggcagcagt aatgacagga gctgcgcctt    192120
     gctcctgact cccgagaatt ccgccagggc ctgcgacagt ggctgatgtt gcgctttacc    192180
     atgggccgac agacgcgacg tgtaagtcgc aaggaaggcg aacggtgact ccgggtcctt    192240
     gcggttctca gcaaggttga aatgcacgcg gccgacgaga ttccaggccg ggtgacgcag    192300
     cttgaggaaa tcctgaagcg agacgtttgc ggtcgccagt tcctggtgca aggcagtatc    192360
     gatctcgccc cacaacgtgc ccagcacggc tggcgtcaga tactcgccgc ccgtcatcgg    192420
     cggtgcatcg tcaatcatgg catcgaaatc cttggcagca ggcgttgcga ccgcgatctc    192480
     gccgccttcg ggcgtggcgc acaaggcagt gacatagcgc gccgcaaaat cacgccacca    192540
     ggcccatgca gggggcaaaa tgcggccgat ttcggccgtt cccaggtgca gcaggccatg    192600
     tcccgcgcca agcgcaaaag aactctcaag ccgctgtcgc gtttcatctg ccaagattgg    192660
     cgcggcgtcc tccggcactg caagcaggtg cccgccgggc gtcaggtgtg gcacaagaat    192720
     gtcgggcgca gtcacaggtg cccgttccaa tcgcactgtt tcagcaagcg ctgaagctgc    192780
     atgttttcaa gggaagcggc tgcgaaatcc accagcaggc cctccggcct aggttggact    192840
     gggtaaatct tcgattgcct ctggaccgac cgaatgatcg gctcaagcaa ccctccaggg    192900
     tatgcctgcc tgctgcgctg cacatgtctt gtgaactgtc tattcatctg ctgtaggaca    192960
     acctgtttgc tagtaatcac tcacgcaaat tcgctcccgg ctccgctacc gaattttgcc    193020
     aaaggcaagc acgactttcc atgaaagggt accaaaacct cagtcacacg agatgggatg    193080
     ccgccggcgt cccccgcacg gcgaaaatca gctggcgcgc ttgttacaaa cgacaaaatg    193140
     gcggagtgtc ccgaatggcc tgaatcgctt cgaaggcgag tgacggggcg aatggcagtt    193200
     gcctcggcag agccgaccgt tcgagtgtct ggagatggcc ggctacgcgc ggcggagtct    193260
     ggcatctcgg ctgcccttgg ccgcgccggc cgagtccgtt gcaatacaac gaagagatag    193320
     acctctgtta ggcaggcaca cgtacggtta tactccgcgc ttcacaacta acgggtaatc    193380
     cataatggtc gctgcaacga aagcaacgaa ggtcagtgca gtctcgaaga acaagtctgc    193440
     cgccaagaag gtggccgtgc caacgaaaaa ggccagcgtg ctcgcgcgtg aggctcaggc    193500
     ggcgaaaaag cgcttgctga agctgcgcgc cgacatgaag aaggccattg aggcagcaaa    193560
     gcgcgaagtt gcgcaggcag tggaagccgc caggtccgcg cttcgcttcg agaagcaagc    193620
     cgcaaaggac aagctggcgg cgaagaaggc aaaggctgcg gacgccaaga aggccgcggg    193680
     caaagtggcc gccacgaagg cagccccgaa aaaggcagtg accggtacca aagcctccgt    193740
     gaaagctgcg ccgaagaagg ccgcagtgaa agccgtgacg aagaagcgga ctcccgcaaa    193800
     ggcagtggtg ccgaccgtgg cgacacccga agtttcggcg tgattttggc ctcggccggt    193860
     atggcacttc gccgaccggt cgatgaccga agatgggcgc acagcttgcg ccaagcctgc    193920
     tcgactgagt cgtgtatcga gccattagct cagcaaatta gaggcaagtt gtgcgaacat    193980
     cagggtagaa tttcgcgcga cgttataggg ccggacgccg tgttggttgc aggcagcgga    194040
     ctcataatcc gccggagaca tcccaccgtg ggttcgaatc ccacccggcc caccaggttt    194100
     gcgtctgcca ttactgctcg atgaggatga actgcgtagc cgatgcattt gccggctcgc    194160
     cttggatggc cgcgcccgag tcgcgcctgg caggtgagcc tagcatcgcg atctttgacg    194220
     atcgcacccg actggtgtgc tatgacagct ccgctggtcg agcccggagg tacaagcggc    194280
     aatcgcacaa cttgaggctc caattctgga ttgctcaggg cgtctcgctg acaaccgatc    194340
     tggcgaattc catgatcgcg cacggctacc gtgctatcgg catcggtatg gctggtctct    194400
     acgccaacgt gggctggcgt aggtcatcga cgacatcgat cgactgaagt tcgccggtcg    194460
     aaggtaggct ggagtggaag ggcgcctacg cctcgcctac ctgaaatgcg ctgattgggc    194520
     gagacgccag cgtcttacat gtcgtctcgt gtcatatcgc aaatccaagg gaagacttca    194580
     gtatgccaga caggtccacg gaacaagtca tagtgagtac aaccggcaat cgtgaccagt    194640
     cgcctgtcgt gcgcggatag gcctcggcac aggtcatgcg cggcgtgggt ctgcccgcgg    194700
     ccggatatgt cgtcgagctc gccttcgatg gtaagcaagg cggtggaacg gatgtcctgg    194760
     ggacgcacca actgacctcg cactcgccag gtgccaaagg cgatctgaaa ctcctgaaac    194820
     acggtccgaa ccgtgtcgag ataaaactcg gcggccatgt cgagcaccgc gctgtagtcc    194880
     agcaatgctt gccagtgaac attggctcgc tcggcatcgc cacgagcaag gtttgcccag    194940
     tacccttcac ataggcccca tagcggtgat gactgcgcag cggcgagacc ggaaagttgc    195000
     acaaaactcg gacagacctg acgtccagca cctgcatagg gatgcggcac tgggtaaacc    195060
     agattgcgtc ggaaccactg gatagagcgg ctcgaggcga ggcgcccaat tgcagtgggg    195120
     ctgcgacgcg cgtcaatcgg accgccgatg agagtcaggc tggttggcgt cgcctcatcg    195180
     cggcttgcca acagcgcgat ggcgccattg ctccagtcag tgacatagac aatgtgctct    195240
     tgcagtagcg attgcaccac gtcgcgaagc atgacggcgt gatgcccggc aagcggcgca    195300
     cagacgagta ccgcgggaat cccttgctgc ccgttatcat gcccaaccgc tggggcagct    195360
     tcaaagcgca gcaggcggca aaaagggctt tccgatacga gttgctcgac cacgggaaca    195420
     acacggccgt cacgaaggat agcggtaacg ccaaacgtcg gttcctcgct ggccgtgctc    195480
     aagcgataca ggttttccca gcaggcggcc aagttcccgg cccccggaag atatgcaagt    195540
     ggactagagg gctgaccaag gctcgggcag attcatccgc ccacgccttc atcagggtcc    195600
     gctgatattc aaaaatctga tagagcatgc ggaccccaaa ccaacgaatg cgtcaggaga    195660
     aagagcgcca tcactccgaa attgcggacg ttgacgcgct accgcaaagc gcattgtcaa    195720
     ggtgcgtggc actcacggcg gtcagcagaa cgctaaagac gctgccctga agccacgttg    195780
     aggtcgccaa cttcaagcgg agatgaccgt tttctgccgt ggagccggcg gctccgtttg    195840
     cgcccaagtt taacgcctag cgaatgcggc gtacggcgtc gagcagagaa tgcccccggc    195900
     tggtcagacg cggatgggcg ccgctgtcat gaccatgctc catcgtgacc agtttctgtt    195960
     ccaacaatgc gtccaaccga tcgggatcga cgtcgtgaac gtccggtgca tcgccaagca    196020
     gcagcagtgc tgcgatttca tgcggactta gcatgtcggt ctccttgatc gagtcaaaag    196080
     ggaactgcga cggctgatct gtgtaccgtg ctccacgggg gagttaggaa ccgcaattgg    196140
     atgatgtcgg tgcaaggaac gcgccgggag cgctacaccg aacgtttacg gtaaatcctt    196200
     cagtcgtgga aagcaagtga ggaatatgct gcggggcagc ggagaagtcc aatccccgat    196260
     tgggatagcg gcccggcagg cggctgcgtc agtgtggccc gaaggtcgtc gtgaaccttt    196320
     caagacccgc gcttttccaa aacgggccaa ttacggacca acgcctctcg gcacgcttca    196380
     agcgatcact ggcctccttg cctgagtgca gttcgcgcga agttcactgc tcaacgtcgc    196440
     acaacggcat tacaaaagct tcagtcccgc catcgtggcg cgtgccggga cactatgcga    196500
     aaactgccga gctcggaagt tttccccacg tcaaggctgc ggcgtacccg tttctgcgaa    196560
     cgttctaacc aaggattgtt agacaaatgc agcctcgagt actcggtcga aattttttgg    196620
     accggccgat tgccgtgagt gtcacggtca gggccacaag cctgaggctg gttcttatca    196680
     gttcaaaccg aggggacttt gcacccgaat cacgcgcatt gttttacggc gctcccttta    196740
     atgcagttct cgctgccctt accgcatgga gcctcactgt ggcgcggcgg tggtactcag    196800
     tcgctgtcat actttctcgc tcagcttttt tggtcatgat tcggagccgc caagcgaatc    196860
     attggactgc tcattaccca gaaggttaaa gtttttatgc cctgaagatc aaattggctc    196920
     taaactacct atctggatct ctcgatcgga aaggaaacca gaagatggca acttacaaag    196980
     aactgatggc gcagaaggca gctctggagg cgcacttgga agaggcacgt gcgaatgaag    197040
     tcgcctctgt catcgagcag attcagaacc tgatggcgga atacgggctg actgtcgaag    197100
     acgttaccaa acgccgtcgt ggtcgtcctg ccggcagcgg cgctggtaag gcgaaagcgg    197160
     gattgccccc gaaataccag gatccgaaga cgggcaagac ctggtctggc cgcggtcgtg    197220
     cgccgtcctg gcttggcaag aaccctaaca agttcctgat tgcagaagag gcgtaaatag    197280
     gcgcagcacg tcccgccaga atagtgtcca acccctgcat gcaggggttt tctttttgag    197340
     agcaatcgcc atgtcatttg aagtgattca tgccgatatc atgctcgccc ggccaaactt    197400
     ggttcctcgt gaacgtaccg agcgggggat acggaacggc tattcctact ggctccggct    197460
     tccgcccagc aaggtactca gagtgatccg cctttcgcac cagtctggcg acagctatga    197520
     gttggtgcgt gcggccagcg agcgcagaac gcgtcagaaa atacgtcaac ggttttccgg    197580
     gtccatagcc gagctgatag ccattattga cgaagagatc gacatccttt gcaaggatga    197640
     gcgcttggta tcgaagcctg gttcataggt ttgctggcca agaccaggcc gcccacgaga    197700
     agcagggcgg tacgttccga tccacgcggc cgccgtgccg cttcagtttc gtagaattgg    197760
     cgccatgtcg accagcgagg acgctctcgg gtcgaagtga agggcctgag ggtgtaacag    197820
     attgggccgc aagacggaat tttggccccc aaagaccttg tgactacagc agaagagcct    197880
     acgaggctgg gcttcgaccg atcgattgct gggatcgtag atgcaggtcg cccattgcgg    197940
     cccaattcat tgcaccttgg ccgtcgcccc cgccaagggg aaagcaaatg cagcgcgaga    198000
     gcctcataat ccattggtcg gtgctcgact cacggggcgc ccaattccac accactatcg    198060
     ttgcgccaac gacactcgcc agcgaccgag cgtacctgtt tcagcgtacg gcagtttggt    198120
     tttgttacgg cgaagcatga cgaggcgctg ccacaagaac caactgtgtc ttggcacacc    198180
     aaccaagccg ccgagtcaaa attgggaagg gcttgcccgt cacgatcaca tagcccctac    198240
     tacgcggctc gcaccggcag gcgccgccgg cgctgctctg tacgttactg gtgtcgggag    198300
     caacttcagc gtgatcatgt gacaacacgt ggtggctgcg cgggagcttg aacttgccga    198360
     ttactgccgt tcccaggaca tggatgtcga cgcggcgcgc gctctcgtcc gagaggtaga    198420
     gagcattttt ttgtaccctg tgagtgcgtg caaacgcgaa aaaacccgaa acgttaccgc    198480
     gtacggatgt aggcctcgaa gagacccgcg tgcaggccgc gtaagtcctt tcgccgttcc    198540
     agcaaatcat gctggcggcc ctggcgctca aggttcaaca actccagcat gatccgcaat    198600
     cccttttcgg gtaatgtgcc cgtcgagggc tcggacgcgc gtaagagggc agcaagtccg    198660
     ggtttttcgg tcaaggacca ggctgggagc cacgcgagat catctagcgt accgtcacca    198720
     tcgaatttcg catcgaaccg ccggcgcagc gccagcaatg acgaatcacc gagcgtttgt    198780
     atgagcgcgc cgagcttctt cggggatagc caagcaagct cggccaagag cggccatgcc    198840
     gggtcaagcc cctgtagccg gtagaccgtc tcggccatcc aggcgagggg agttggaatt    198900
     cgtcgccatg acccaattcg cttgatgctg tcagatgctg cagtccactc cgcagcgcgc    198960
     atccataggg gtgccgcatg ccattcgggc atctcccggt gaaacggcaa ttgagaggcg    199020
     gctcgggcaa cagcacgcca cagcggtagg caccaagcca tgcccgctgc gtcgccgaat    199080
     gctcggcgcg ctgccggcat gcacggcaaa caccaccctt cgcaggtgtc gcgcagtgcc    199140
     gtctgagtcg cgaagtgttc gtggacggga gcctccagca cacagacaag tgtctccagg    199200
     gtcggcacaa gcgtgtcgtc cggatattcc gcgaccaggc gctgcagtgc ttcacgcccg    199260
     gcggcggcat tgcgttgctc aagcgctgtg agcacgtcgt tgcgaagcat gacatcgcgg    199320
     ccatcttcaa aaagatcgag ctgattcgtc acggcgttcc cgttggtagt cagattgcgc    199380
     ccctgcagga ccggcccgac atcgccgggc acaacaagtc ttcagggatg gtagctgctg    199440
     ccgcgactac gggcaatccg caaccggcca accagatctc gacgagacaa gcgctacccg    199500
     agggcggcca ggcaaatcaa ggcgcgacgc gtggcgctga ttctgccttg gacttcagga    199560
     ctccgcccat acagcatcga catctctcga tagatgtcca gcgaggatgt agtctccgag    199620
     cttctccgct tttccctcca ggcgctccaa gtcagccgct ggtagcatgc tgagctcaaa    199680
     ttggcagtaa agattgcgct gacggaacgt caactttgga cgactcagtc ccgcaacgag    199740
     tgcggcgggc gagctgacgg caatgctctc atggccgcga tactggacac gtatgccaag    199800
     cttttcgccc agcctgccca gctcaatcgc atcctgccat cctgattcgt agtccaattc    199860
     cacgaccgtg acgcccactg tttccaggag ctttagtgct tcgcctttgg tcgcagccag    199920
     atctgtcgcc attgccgcct cccctgctcg taggacctgt ggcgattcgc gcgcttcgac    199980
     ggcccagatt catattgcat agcaacattg taagcgggga acggtctatt tcgtcaggtc    200040
     ttgtcgtctc gcgtaccact ttgacttaag cacctgtacc ggtcgaggca gtaaccttgc    200100
     gggcgcaagt cgcgattacg ccttcgacag atttgtgatc aggtagattg gtgatcattc    200160
     agagataatc gggtgacagc ggactgccac tttgcaaacg gagcgcgctc gataggtcat    200220
     gcacagttgc acgaggtcat gcagggcgct tttacccaga ccgtggccga gacgcatggc    200280
     gggcctacac ctgccggccg ttcagattca ccgccgtcga ttccatcaaa ccacgtcacc    200340
     tatcccaaag accgatgtct gaaggccacg tattcatttg cggcgacccc catggcgagt    200400
     tcggcccgct gattgaaagc gtccaccgtc accgccccga agcagtggtg ctcgcaggcg    200460
     acatccaggc caggcgccca ctggatgaag agctcgccag catccttcct ctgacgcagg    200520
     tgtggtggat tcctggcaat cacgacaccg acagcgatgc cgactacgac aatcttttcg    200580
     gctcggccct ggccgaccgg aacctggatg ggagggtggt cacgatcgca ggccttcgga    200640
     ttgccgggct aggggggatt tttcgcggcc aagtctggat gccgcccgaa ccagcgcgca    200700
     tggagagcga gtctgactat ctggccaaat gtgggaaggg gaattactgg cggggtggtc    200760
     tgccgcggcg ccatcgcagc acgatcttcc cgcagaccta caacgcgtta ttgagtcagc    200820
     atgcggatgt cctggtcagc catgaggctc cggcttgtca cccacacggg ttcgaggcga    200880
     ttgacatgct catcgaagca atgcgagtga aacgagcttt ccacggccat caccacgaat    200940
     ccacggctta tccgaccgca ggaccgtgcc gcatcttcgg tctcggtgcg tgcgcggtgg    201000
     ccacgatcga gggcgagttc ttgcccagcg tcctgacttg tccggatcaa gtcgaaggag    201060
     gctagaccaa cggttgaggt tcacgggcaa cgctgtgggg cgccagcggg ccgggcaaac    201120
     gactggcgcg tttgcgaatt gtgcacgatg gtcagaccgc ccgcaggtca acatgacacc    201180
     ggcagatccg gtgatcgatc gcgcagcggc ggcggccgtc ggcaagttgg acgcgccggt    201240
     tgccagatgg tgagtgcgac caaaaaaaca gccctcgatc cgatggagga gagccgcaga    201300
     aacgtccaag aagaaatcgg gaaacacctt gcggcgccac ccacattcag tacccaccag    201360
     gttgccgtgg acggcaatcc agcctggcgc cgcgcagttc accggttcgc gaaaaaagaa    201420
     cccgcgctca tcaggggacg ggcgcgggtg gtagcaggac ctaccggagc aggatacggc    201480
     gatataaaca tcgcgcaaca caggattagg aggctttttt cccggcagtt cttttgccag    201540
     cgaaaaaatt gtcatgtagc gggcagacaa tggaacgatg ggtggagcct ccgaccttgc    201600
     agggccgcct cgatgctgtt ggagcgctcg gcgtgacgca ttgagtcgga tgcactgctc    201660
     gccggagaac tcacacgcgc gcggacgtaa aaagcgaggg agggtgccgg cgttgaatcc    201720
     tatggacgct gcctttcccg cgacttctgc gcagtgtcgt cggtttcctg cagggaatga    201780
     agaaaatctc ccaccagtgc gacacactcg tcaaagcatc tgttgaaatt aatccgctgg    201840
     atcctgtcga actgctcacg catgatcggc gggccggcct cgacctggcc ccggaaggcg    201900
     gaggcgtgtc gaagcagaaa cggcgcagcg tgtgtgtgtg ccgtcggttc atgctcgacc    201960
     acgacggcca ggtcaaagag atcccgcgca gtggcacggt cgccacgatg gtaaagcttt    202020
     ttggcaacga tctcggccgc ggtctccacc ttgacggatt gccccatgat ctcccagatt    202080
     tcgaatggct tgtcggtcag gttgggcgag gccacgacgt cgatttcccc agcgtcgagc    202140
     accagcttca cgaaatcccc ttgctcaacg tagtcgctcg tgatgctttc cgcggcctcg    202200
     ctcaaacgcg gcgacacgaa tcccaggcat tgcggatccg ggacaaagag gtcgatatcg    202260
     cgggaaaaac gatggcggta ccgaagcatc aggaccgtcc cgccgccgaa ggtccagaac    202320
     ggctcaatgc ccccgtgctt tctgacctcc tccatcagcg taaaggcatg agggaacagg    202380
     ctttcccaga tgtcgccctt tagttcaact ttcatgccca caggcctccg cgcgtgacca    202440
     tcaaggtctg cgcaagccgc ctgaggttct tccagatgtc ggctggattc cgatgttgct    202500
     tcgccgctac ctccgcgacc accttggtga cgagttgcag aggcgcctcg tccaagacat    202560
     gggccacctg tggacgatac tccgacggca cctcgccggt ggcgagggcg cgctcgagct    202620
     cgtctggcgt gagctcgccg gtgtagctca cgttggcgcc cttcgcggcc atccacagcg    202680
     cccgcattgg cgacccgcta gccaggcggc gctcatcggg atcgtttata tcaagtgcta    202740
     agccgagcac atccatcagt cgcccgagcg actggagcgt agcgttgacg ctgccgtgtt    202800
     caatgccgtt cagcgactgg cgcgacagcc ctgccatgtc ggccagctgc tgttgggtca    202860
     gccccaaggc aacccgcttg cgctggatcg cgttgcccaa gagagcggga ttcatggcga    202920
     taatctccaa acatgtgtca agtatagacg acaagatgga tggttggctt tccgcctatg    202980
     cgggggacga gttcttggga tcccgaaggc aagactcggc gtgcgatacg tcagatcgcg    203040
     ccgcgtgagc ccagcacgat ccgggcggtc cgccggtcgc acgcgggcgg ggctggacga    203100
     cgctggcgac caagcttggc gatggcctcg tgcttatccc ctgagttcgg cagtcacata    203160
     tttgcgcggc gcaacatcca ttcaaccgcg cgcacggcgt ttccggtcga tcagcgcctg    203220
     agcgtcgtcc atgatctggt catgtggggg cggcggggcc gggtcggtca gcgcttgctg    203280
     gacctttgcg cggaaccaag catcataggt ctcgggactc gtcgtcagac cgggcggcag    203340
     cccgccttcc ttggcgatcc gtgtcaacag aatgcgcact gcgtcggaaa cggttaggcc    203400
     gaccctggcg aggttttgcg tggcgcgggc tttcaggtcg tcgtccaccc ggatgtgcag    203460
     cattgaagta tgcgccatga aaatctccta tgcattgacc gacattatgt atctcaattg    203520
     cgatataacc aaggtaagcg cattaccttg tccgcaagcg ccacgctacg ttcagtgagt    203580
     cgttgcggtc atctgtacgg aacgcatgcg gcaaccgcct cgaagaagtc agccgtcagt    203640
     tgtcacgtaa caatcgacag cacgagactt ccgagcgctc aaagcgcctt atgcaatact    203700
     ttacccatca tcgctgacat aacatcctat tcttcagaag tgcgttgggg ctcccaaagc    203760
     tcaaggggca gacatgcggc tagctgactt tatcttgcgc gatatgaagc acattttggg    203820
     ggaataagag gcgtttgtgg ccacccagct gcctgccgca cggaatctgg attctctcgc    203880
     cctgcgcgac ccacgcaccg cagatcttcc aagccattgc caaagatctt aggacccccg    203940
     caaacgagcg aggcgcagcg cgaaaaatcc ttgggacgag ccccgaaggt gcccggtgcg    204000
     ccggacactg cagcccaaat tcacgccgtc atccgggcgc gcggtggctt caacatcaac    204060
     cagttggtcg ccgagtaccg ggcgctacgc gcgagcgtgc tgcgtttgtg gatggacgag    204120
     tttgagttgg tcgccgggga tctggatgac gtgatgcgat tcaacgaggc gatcgatcag    204180
     gccgtcgcgg aatcggtgga ttttttcaac gcggaagtcg agcagtctca caatctgttg    204240
     ttgggaatgc ttgggcacga tctgcgcagt cctctgcaga ccatccagat gaccgcctcc    204300
     tatctggcgg cgctgaacgc cggggagaag gtgtcggagg cggcagcacg gctcattcgc    204360
     agcggggcca gcatgaattc cctgctggat gatctgtgcg atttcaaccg aacgaaactc    204420
     agcttgggta tcaacatcgc tcccattgag gtcggcctag ctcacgtcgt tggcgatacc    204480
     gtggatcagt tgcgggcagc gcatccggac cgccgcatcg accttgagat gaacggtaac    204540
     gcgctgggcg tttgggatgg tttgcggctg cagcaagtgg tttccaatct ggtgctcaac    204600
     gcgatcaggt atggcgcacc agacgccccg gtccgtgttg tactcactgg tgacgacacc    204660
     gaagttcatc tcgcggtgag gaacagcggc cccgctattg accaactgac gctggcgcga    204720
     atgtttgacc cgctaagcag aggtccggat ccggaagaca agcacgcgca cgggctcggg    204780
     ctcgggctcg ggctcgggct gtatatcgcg agcgaaattg ccagggccca tcacgggtca    204840
     atcgacgccc gctccgacca ggcagagacg gcgtttgagg tgcgtctgcc gcgtcgagca    204900
     tcccaaacga cttgagtggt gcggtcgctt tgcctgcccg ggcgtcgtgc agtgccgtcg    204960
     cgatttgccc gagcacacgg catcgtcagg ttcctgtccg aatgcgggac cgggattttg    205020
     tcgtcgcggc gacggccggt gccgccggga tcggctcaaa aagggcctcg atgtcttcgg    205080
     cggagaattt gacggcgccg gcggcatcct ccgacaggat cgcctcggcc agcgcggctt    205140
     tctgcgcttg catcgcgacg attttctcct cgacactgcc accggtgatc agcttgtaga    205200
     cgaacacggg cttatcctgg ccaaggcggt gtgcgcggtc agtagcctga ttttccacag    205260
     caggattcca ccagggatcg tagtgaatga cagtgtcggc cgctgtcagg ttcaggccaa    205320
     cgccaccggc cttcaagctg atcaggaaaa gcggtacctc gccttgctgg aagcgttcga    205380
     ccggggtgat gcggtccgtg gtatccccgg tcagcatgac gtagggaatg ccggcgtttc    205440
     gcagggctgc cgcaatgaga tccagcatgc tagtgaactg cgagaacagc aggatccgac    205500
     ggccttcctc gataagttcg ggcagcatgt gcagcaacag gtcaagcttt gccgactcct    205560
     tgatccgggc cgcctctttg atcttgacga gccgcggatc gcagcagacc tggcgcagtt    205620
     tgagcaacgc ctccagcacg atgatgtggc tgcgcgcgag gcccttggca gcgacggccg    205680
     cccgcacctt ttcctgcatg gcagcgcgca ctgtttcgta cagatcgcgt tgtgcgcctt    205740
     cgagttccac cgtgcgcacg atcgtcgtct tcgggggcag ctcggtggcc acctcatcct    205800
     tgcgccggcg cagcatgaat ggccggatgc gccgcgcgag caggtcgcgt cgaacggcat    205860
     cgccgccctt ttcgatggga gtgcgccagc gtcgcgtgaa gtcctggcgg gtaccgagaa    205920
     agccgggcag caggaagtca aactgcgccc acaattcacc gagatggttt tcgagcggcg    205980
     tgcctgtcag gcagaggcgg tgtcgcgcac gcagtgttcg gatggttgcg gcggacttgg    206040
     tggcggcatt cttgacgtat tgggcctcat ccagaagcag caggtgatag tcgtggccgg    206100
     caaggattgc ctcgtcacgc cacagcaagg cgtatgtggt caggatcagg tcgtgctcgc    206160
     cgatctggtc aaagcgatcg tgacgctggg ggccgtgcag atccagcacg cgcagcgtcg    206220
     gcgtgaagcg ctgggcttcc tcgcgccagt tgtgcacgag ggtcgtcggc acgacgatca    206280
     gcgcaggccg gtccagccgg ccccgttcct tttccgtgag gacgtgcgca agggcctgga    206340
     tcgtcttgcc cagtcccatg tcgtcggcca gtaccccgga caacccgtgc tcgcgcagga    206400
     actgcatcca ggcgagcccc tggcgctggt aagcacgcag ttcggccgtc aggccgcgcg    206460
     gcacgggcac gtctgccatc ccgggacccg ccatcagccg ctgcgcgagc tgccggatcg    206520
     atgccgcgcc gtcaaactgc cagcgcccgg tctgatccag ggcatggagc cgggctgcat    206580
     cccactcgga aatgcgcatg ccggtgttga gcgcgtcgaa caggtcgatc agcacgcgca    206640
     cgacgggttt cagccggtcg gcacccaggc gcagccgctc gttgcgctcg gtcttcagat    206700
     caatcgcttc gtcgtcgggg atgccatcca gcctgcctga caaccagcgc gaatcccggc    206760
     gaaagaggtc agccagcagc ggctccagac gcaccgtacg gccgttgaca gtgatgccca    206820
     tctcgacgtc gaaccagcca tcaccggtct gacgcaggcg gccgtcaatg gcctcgatct    206880
     caatcacatt gtgccgaaac gcgtccgtca tgacgacgcg ccagccactt gcgcgaagga    206940
     tcggaagcag caccttcacg aggcttggcc agctggcatg gtcctcgggg ccgagcatgt    207000
     cggccggaaa cggggctggc ccaaagacat ggtcggcccg aatcttccgg aacccggcct    207060
     gttgcagttc tgtcagacgc ttgcgctcga gatcggcgtc ccgtttgatc tggacgacct    207120
     cgccaccggt ggtttgaagg agagtggtgc tgctgtgcgc cgggaggctg tgtcctgcgt    207180
     aatcaaagct gaccgtcgca aaatcctgcg ccgaggccca tgtcgacaac gtgtccaggg    207240
     ccaggacggg caccggcgcg cagtggatgc ttcgcaccga cgccgtttca tgcgcaggcg    207300
     gcatcgggag ttcgggcgcc acgtcacgca gcacattccc aaccagtgcg gcctcgtcca    207360
     gcgtaatggc cggcatggac aggaaatcgg cgagctgttc ggagggccaa ggcatcgcca    207420
     ggatgccggc ttcaccagca tccgcgtcga cgtaccagca cggctgggtg ctcgtcagca    207480
     acagggaagc gggtggttcg gcttgcagaa gcggccgcac gcgcgtgtcg ggctgcgcct    207540
     gccaagtcag ttgcgcgccg cgcgcggctc cgacttgcag cgcacagtgc gtgccgggat    207600
     agtgtgagcc cgcgggcgaa aaggaaacaa aagcccgtcc ggttgccatc agttgctcca    207660
     agatgacggc accggttgcg ccccgcaggc caaaaccacc catataggag gcatgtgagc    207720
     ggcccagcca tagcccgcgc aggatcggca gatccgcttc ggtaacaaat ttggggggtt    207780
     cgaccagcgc cttctcgatg ttttgccacg gatcgtcaag cgagcgaatc gtgccgtcgg    207840
     cgccaacgcg tgccttgtaa atcgttacct cgccgccgcg gtacgattgg ccgatcacgt    207900
     aggctagggc atgcgtgggc ttggacggct ttttcttggc cgcgggattg gcggccgtgc    207960
     gcctggcacg aaagccttca agccagctca ccagttccgc gcgcacgccg gtggacggtg    208020
     gcttcggctg gtgcgccagg ccggcgatca gcagcgctgc cacatgcttg cagtcgaccc    208080
     caactggaca cgtgcattcg ccttccaccc acatgtcgtc gtcgacgtcg tggaaataca    208140
     cacgcacgtc atacggacgc gtgcgggtgc cttgcaccag gcccgccagg gtgtcctcgt    208200
     cgatccagcg caactccgag acggcactcg catagggacg cgccttggac accgtgaacg    208260
     gatccagcca ttgcgcgatt tgcctggatt ggtaggggac agacattgac tgaaggaggc    208320
     cggtggacaa cgtcgggagc attttacgcg gctggactcg cgaccggtaa ggcagcagat    208380
     cccaaatcga aggcgagctg gctcgtctcg gtaggctggg ccggcgatcg tcctcggcgg    208440
     ggaattcgag tcgtcgtgat cgacgcgggc ggagatttcc ggcgggtgtc gacgccgctt    208500
     cattctgcgg ggagggccgg cgtgtgcctt cgtcagcagg tcaatgccca actctaatgt    208560
     ctagtgggta cctcgaccag aatggcgcaa cggggtcggc cgcccggtcg aacaattccg    208620
     ggaccttccg ggacgatcag tattccctgt ggcaaggtgt cgaactgacg ctggagtccc    208680
     attgatgtac aattgaaacg tacatatcaa gcaagggagc acctttccat gcaaactatc    208740
     ccgttttctg aggcaagagc gcacctcgct gatgcgctgc gaggtgtaga agtggcacaa    208800
     gagcccctac tgatctcccg gcgcgggcag gctgccggcg tcttgatgtc gtggtctcaa    208860
     tatcgacagc tggttgggtc ttcctctggc ttttctgcgc gtctggcaga gtggcgccaa    208920
     cagcatttga cagaagagaa tgagagcgat ccctttgcgc aagtacgcca acccgatggg    208980
     ggaagagaat tctcatggtg agcgccgtga gttggttgct cgacaccaac attgtttcag    209040
     aggccatgcg gccgagacct gaggtcgcgg taacggacaa tttggcccgc tacgaggggg    209100
     agctagcaat tccggccccg gtctggcacg aactccgtta tggctggttg cgcatgccgg    209160
     atggccaacg gaaggacgca gttggccgtt ttgtgcaaga tgtcgtgggc actttgccag    209220
     tcttgcctta cgacgctgcc gcagcgcgga tccacgcgga gctgcgccag tcacgcgagc    209280
     gggctggatt cacattgcca ttcgtggatg ggcagattgc atcggttgcg atagcgcatg    209340
     ggctaacctt ggtgacacgc aatacgaagg atttttcgga attgactggt ttgcggctgg    209400
     cgaactggtt cgtcccctga ttgccgcgag gacgaggcga tcatcaaggc agccatcgac    209460
     gccggccagg aaaaaggcat tcagcagcca ggccgatctg cgcaagctga ttggtgtcga    209520
     cctggcgtaa tgaactggaa cagcacggaa aaacggaagg atggtgctga cgttgaaaga    209580
     tggagaaccg caaccggcga tggacgttag atgacatgtc gccgctgcga ccgggcatcc    209640
     acgtgtgggc catggatgca aagcccgcta tgcccgggaa gacgcggctg gttgaagagt    209700
     ttcgttctcg gcaattattt ctcttgcggc gtttcgcgaa tccttttgcg gagacgatga    209760
     gacagatctt ggatcctggc gtgtcggcgt tgcgtagtct cctgcgctgg gaaacaatcg    209820
     gttggaggaa gtgctggggc caacaacgtg gatatccgct ttaatcgcaa cctaagcgct    209880
     ggctccgcgc gcgtaactcg ccacgtcatc ttgacccctg caatagtggc tgatctggtc    209940
     agtccgcggc tcggctcgct gcggctttga acgccgagga ctgtcgccgt caggcgcgcc    210000
     gcgtgcgcct ccgcgcgatc acgggcgaag ctggaggggc tgctgccacg cgcccgcccg    210060
     cctcgccgcg gcctccttgt tctagcccat ggggccagga acaaattctg caaaaaccga    210120
     acgcggtgca gcagcttgtg gagcgccgcc ttgcgctttg cgatgggcca gtcgcggatg    210180
     tggcccgcac agttccgcaa catgaaggca atttagggcg cacggtggat tctctccaat    210240
     tgtctacgca gggcgtagac aattctgcgt acaatgtcta aatgtgactt atatttaaca    210300
     taatgattgt tatgcgcgct gttggtatgt cctgaagtgt tgcgtgtggg acggcacgga    210360
     ggcttcaagt accgcaacgg aaaagtgctt ttatggtatc tttcgccgtt gcgttttgtt    210420
     gtgggtttta tgttcgttca ggtcagcgcc gccgccgtgc cgcgggcgct ccggggggtt    210480
     gcgctggtcg acagcaacca catgcccagg tactgggccg cggtctggct ggtcatcgcg    210540
     ggtgctcaat gggcaaagtc cacgcagacc atgcggctgc ggtacatcga gaacctgtat    210600
     gagcatgcgg atcggtcatt caaggcgaat gccctggatg acgcgctatc tgaccttgac    210660
     gatgcccggc ttgcggacat tctcgagtcg tggttcgtga gtctgcgtaa tcagcctgtc    210720
     gccactcgca gcaatgagga ccggtggcag accggactgg cattcgtgac atcggtggtc    210780
     acatggctgt cgaagtcggc ggacgcgaag atgcgacaga tcgaagcgcg catccaccga    210840
     ctatcaactc tttaccgcca gcttcacatt cgccaaggtg cccgcagcga gaccgttcgg    210900
     tcgttgccct ccagtgtggt cgagagtctc tatcagatcc tggatccgga atcggatgcc    210960
     aatcccttcc agcgcgcgca cacgcgctgg cgggtcttca tcgcgttcgt gctgatgctg    211020
     catcagggtc tgcgccgcgg cgaactgttg ctgctgccag cggacgccat caagagcagc    211080
     tatgaccgcg aacttggccg gacaaggtac tggctgaacg tccggcaaaa cgagtatgaa    211140
     gaagtcggca gcgacagccg ttactcgaaa cccagcatca aaacgcgcca ttcggtcagg    211200
     caaattcccg tcagcgacgc aacggcgggc ctggtgcaga tctattgcga aaattaccgg    211260
     ggccggcctt cccattcgtt catgttaagc gcccagactg gcggccctct ttccacagag    211320
     tcgttgacga agatctttac aacgatatcg aaagcgttgc cagctgatgt gctgaaggaa    211380
     ctgcacgacc gcaccgaaaa gaagtcggtc acctgccatg acctccggca taccagcgcc    211440
     gtattgcggc ttcaccagtt gctggagcga ggcgactcga tgcccgaagc gctgcagaaa    211500
     ctgcgtacat tcttcggatg gtcgaaagag tcggacatgc cttcgcgcta tgccagggct    211560
     gtctttgaaa gccgactcgc gagcgtatgg aacgacgcgt tcgatgatcg tgtggccttg    211620
     ctgcgcgcgc tgccgcaggg acgctgatca tgctagaggt cttcccttcc cggcttcgtg    211680
     ggcaagccgg gccatcggtg ctcgaaagca tggtggcgtc attgccggag ctaccgcccg    211740
     ttgtacgcta ctacgacgac ttcgacgaca aactccgctc cattccggca gtcggtcaga    211800
     cagatgtctt tgggcttcac ctcaatggtc ggatgggccg gctcgacttc ggccggtatc    211860
     ctgctgtcta tggcgctctg cagaagcatc tactggtctt cctgctgggc gaagacgtgc    211920
     atatctcgac ctgcttcaat gtattgagcg cagcaatgca tctcgaggtg catgacgtcg    211980
     accgcgttgt tgcagccggc ccaacccgca tagcaacgat atggatggcg ctgcgcgcct    212040
     gtcagttgcc ggttcatgcc tatcgtttcg ttaagacggt tctgcggctg ctatgcaggc    212100
     atcgcctgca cgggtggtcc gagtcgtatc tgacctatgt cagcgccgcc ctgcccggcc    212160
     ccgcgtcgga ctcatatgct ggtgtgcggt caggggatgt cttcctgagc gctgatgaag    212220
     aagctgtgat cgttcgctac ctggacgaaa catcggatct cgtgaggacc cgaggctggt    212280
     caggcgtcgc gcatgacaag ctttgcgagg ccgcgatggt gctctgttcc tatcagttcg    212340
     ccatgcgccc cattcaggtc gcgatgctga cgaggcgtga tgtacgggtc tggcagccag    212400
     aacccggcgg cgaaccggct gttcacctca cgttcgtcat ggtcaagcaa cggggacggc    212460
     ttcgcaaaag gccgatggtc cgtcgtgtga aacaagagtg ggcggtgctg ttcacggccc    212520
     cggtggcaca tgcagacttg cacggtcgcg acgcgagcga tcgcgtcttc gacgtcagat    212580
     ccaatcgtga agccggctct cgcattgccc gctgcgtgga acgcctcatc ggggatgacg    212640
     cttgcgcgat ggaccttcgc catacggcag cccaacgcct tgttgacgct ggtgcaagcc    212700
     acgaggagct cgccgagttc atgggacatt ccgatgtacg gaccgggctg gtgtactttg    212760
     cggcgtcagc ctctcacgcg gaacgggtca accgggcact cggcgcgtca gagatatacc    212820
     ggcgggtggc aaagatcgcg cacgaccggt tcatctcccc ggaagaactc acccagctca    212880
     agggagaaca gcagatcgcc ggcgtgcctc acggcatccc gatcgccggc atcggcggct    212940
     gcacgtcggg gcaaccagcc tgcccttaca acccggtgac gtcgtgctat gggtgcagga    213000
     agtttatgcc tttgcacgac aaaacgatgc acgaaagtgt attggccgca atgcgtgaag    213060
     tagtctcgct cttcgagcag agttcccgtg gtgatgcccg atcgccggcc tacctgcaac    213120
     tgcagcgcac gatcgccgaa atacaggcgg tcatcgacca gttggaaggc gagcgccgat    213180
     gaacccacac tactctgcct tcatcgagtt gggcaaggca ctcgtccgtg aaaagagcct    213240
     gcagtgggac atacctttgg acagcctggc ggaggatctt gaccagatcg aaattccaca    213300
     ggacgtcgag atcctgctcg gcgaaaaagc cggcacggtt gcccggctca tcaagggtgg    213360
     caaggccagc ggtccgatcg tcgatgcctt ccggcgcatc cagaaaacgg aaggtgacgc    213420
     ggccgcatac gagtacctgc gtgccgaagc agacggattc catgctaccc cttatgggca    213480
     ctgcctgaac tcattcacgg tcgatccgtg cgccaagcat ctggaatgct tcgccgactg    213540
     tcgccacctc tcggccactg acctgccaga gcacaggcgg aatctgattc ggctcgaggg    213600
     ccagctcaag cttgccgtgg aaacgatcaa ggcccgccca tcgaccagca ttggttggaa    213660
     aaaccagctc gaccacgcgg aaaagcggct cgctggggtg caagggctgc tccaaacgca    213720
     gccgggcaag cgtcccttcc ccgatggcat tgacctctcc ttgccccgac gacggggagt    213780
     acttgatgaa taaaaccaat gaagtgtcgt cggccgacga cgggaaaatg cgtgagatcc    213840
     ttgaggtgtt gctgaccgac gacgaggaca tcacggcgcg cgccgtcgcc cgactgcatc    213900
     cgtccatcag ggcagcgtcg tcgatcaccc gcagcgagtc acgccgcagg ctgcttgccg    213960
     agtatcagca gcgccaagcg gaataccggc gttggcgtgg ccgcgctgcc aagcaatctg    214020
     gcgctgacat ggctgcgacg cttgccgaca aggacctccg gattgcggag cttgaagcca    214080
     ccgtgcaatt gctaacggct tcccacgtcg ctacgctacg tgcagttggc gaactgggcg    214140
     gattcagcaa gtgggccaga ttttacgagc agtatcgcga cgcccgggac aagcttgcag    214200
     aactcggcgc catacccgaa gcggcaatcg tcccgatgca ggagaactct aaacgccgga    214260
     actaagcgcg gcgaagatga atgcctccgg cgtgatactg tttgcattga tgctcgcagc    214320
     cacgaaatgg ctgcggttcc gcggcggaag ccgtctctct cccgaaagga gcgttcatgt    214380
     cctattgccc cttcttccag accctgcatg acgaaactcg ccctgtgggc aacctcggcc    214440
     ggggaacaca ctactccatc ctgcgggcgc cggtctggca tgacgagctt ctgaaccggc    214500
     tcgatcgctg tgcattcctt gacctcgcgg tcatctggga cgaggaccat gacgatcgcg    214560
     tgatcgacgc gctcatgatg ctctacgtcg gcggcctgct ctcccctgtg cggtatatcg    214620
     gggagcgcaa gggtacgctc tctgtgttgt tggctccaga tgcaatgcgg acctggaccc    214680
     cgaaggcgct gcagcagtat cgcgacgata tcgagaatgt ttgccagtgc ctggaagatc    214740
     cgtggacggc aaaagttgac gccatcgatg ggcgcgagca ctcgatcatc cacagttcgg    214800
     ccgagaacgt ctccatatat ctgcgcaaca tcgacgtgct gtgggaactg ggggtcaaac    214860
     caaagacgcg atcgtagtcc cgcgccttag tgcgcaacac gcaacaccgc agtcgtcaga    214920
     ctcccggcct ggcgtgtcct tccgttgcgc ctccacacaa aactcaacgc aacgaagacg    214980
     ggtgccacgg gcacgcaaca catgccagcc aaaaaagtgg gcgccctgtg gatcactcgg    215040
     ccgtcttccg cctgagatac aacaaaaacg gaacacccga accaacgcaa cgctaggccg    215100
     taggtgccaa gaatgcgcgc tgagccgtat aagtcacttt agcctagagg ccggcgatac    215160
     attgggatca attgggctat aattaggtat caactgatcg accaggtgcc gccatgctag    215220
     tcgtctcgcc cgagaatatc agcgccgtga tggcgctgtc gccgccccgg ctatcgatcg    215280
     cagaactgga cgcggctgtg cgcgaaggcc tccccaagtc cgcgctgcgc gagatcgtcg    215340
     accacgtcgt acgcacttcc gaggagcgcc gtgcattgat gtcccgcatc gtgccagagg    215400
     ccactttcaa acgccgcagg gatcgactca ccccggacga atcggaaaag accgagcggc    215460
     tggcgcggat ctttgccacc gcgaacttcg tctgggacga tgaggacgac gcgcgggcgt    215520
     ttctcaatgc cgcccatccg ctgctcggcg gcagtaagcc gttggacgtg gccatgacgg    215580
     agctcggcgc caggcgcgtt gaggaactgt tgtggcggct cttctacggc atgtccgcct    215640
     gatgcggatc tttcggattg cggaccgtcg gcacgaggtc tggaacggca cgggcgccat    215700
     gctggtcggc gggcgcttca acagccccgg gcggccagtg atctatggcg ccttgagctt    215760
     cgctggcgca atgcttgagg tgctggtgca tgcccgaatc ggcaaggtcc cgcgccatca    215820
     cgtcttggtg atcggctcgg tgcctgaaga cgtgtcggtc gaacgagtcg atgtcggcca    215880
     gctgccaacc ggctgggaca cgcaggaaga cccccgtgcc gccagaagct ttggtgatcg    215940
     ctggctggcc gagggccgct ccgcagtcct gctggtgccg tccgtggtag ctcgcgggga    216000
     atggaacgct ctggtcaatc ccacgcatcc tgacgcccca cggatccaag tttccgcgcc    216060
     ggagcctgtg caatgggatg acaggctttt tacgcctcat tcgttgtaac gaggccgtac    216120
     gcgcggcggc aataggcccc cagctggcgc ttgcgagata gctgattttc gtttcggtcg    216180
     cggttgccgc ggccatcatg gcgacgcaac cttctgccgt aatgaacaat accgcggatg    216240
     gcggtaaggt ccaacactcc ctgagctgag cgcggcgtac ccttgacttt gccggtgtgt    216300
     cggtaatctg gaagcatcat cgtgaatacc gcttcccatg cttaccccac cctcgcaact    216360
     gtccctgttc ccgaccccgt cgaatcgggc cgccctcacc catgcgctgg cgctgttgcc    216420
     gctcgcctgt tccggcacga agttggaccg cccgatgcga gctgcgctgg ctcgccgtta    216480
     tggcgtggtc ccgcagttgc tgcaggagac tgagggcggc atcggcatgc ggcggtccca    216540
     gttcggcgcc ttcctggatg gcctagcgcc ggcattcggc gacaggatcg gccaacatcc    216600
     aaacggcaca ccgctctatc gccggtatgg cgggatcgag gccggcgcca tcgccagcct    216660
     gacctatcgg gcagcgccct acctgcctgc acgcagggcg cgcgtgctgt cgctcttcaa    216720
     tggtccgagc ggtccgacag ccgacgtcga ggtcgaagag gtcatacgcg gtcgcacaaa    216780
     aatttgcgcg cgctgggtca gcgtcgcgga tcttcatcct tttccggtcg aggtgccggc    216840
     atgagcgttt tcgatcggct gctgcaacaa gaggcgaacg aactgtgcca aacgggagcg    216900
     ggaacgcccg ggaagctcat agcactgact catgcaggat tccgggcctg ggccaatctg    216960
     acttttccgc ccgagaagcg atttgcgctt ctgcaagaaa ttctgcgcta ctgtgcctcg    217020
     caatgtttgc tggcctgctg cttcacgcag gaataccgct tgcaggagat cgcgcccaga    217080
     catgaccatg ccgccgcatc ccaagacgca ggccatcacc caccatgtgc ccgagcatct    217140
     gatcgaggcc ttgctgcagg cgactgacga atttttcagc gccgcgcgtg gtggccagac    217200
     ccgcgggcag cgcgccgtgg aagtccgcgc gcaggatcgc cacgcgggac tggattcccc    217260
     ggttcagcgc tcggttctag agcttgtcag ctactcgacc cactccgcat ccacttcccg    217320
     tagcaagtgt ctagccagga tgtagtctcc cattgtcgct gcctttgcct ccaatctgtc    217380
     caactcacct gctggcagtt cgtcgaactc aaactggcag taaagatttc gctgccggaa    217440
     cgttgtcttt ggtcgcaata ggccggcaac gagcgcagcc ggcgagcgga cggcaatgct    217500
     ttcgtgcccg cgatactcga cgcgtacccc aaccttgtcg ccgagcctgc cgagttcaac    217560
     tgcatcttgc caacctaact cgtagtccaa ctcgaccacc gttactccct ctgcttccag    217620
     gagcttcagt gcctcccctc tggttccagc tcgagctgtc gccattctgt cctccgctgc    217680
     atccctcggc ggccccgtgt attagcccgc cgcaaacagg gcgtgtggct attcgtgcgc    217740
     ttcttcagcc ctggtcctgt attgcacagc aacattgtaa gtggggggca gcttcgtttg    217800
     ctggatgcgg tccttcgagc ggataggaat ccttgcatac tgctgggaaa accctagttt    217860
     ctaagggcgg gcacggcggt cagccagaac agctggttgg ttgtgtagga gaagccggcc    217920
     gagtgcgggc aggctgaccg ccaccacgct ccagacttgc cagatggcaa aggccaggaa    217980
     aagcgccggc acggaaatcc agaggattga tcttggctat cgcctcgcct tctctttccc    218040
     agaacgcttt atcctcagga gtccagatgt aaagcgtgga tccacgacga gctgacagat    218100
     cgtcattgcg catcggcatc ggctctccag tgcgatttcg agaggcggca agctagaatc    218160
     cagcgaaaca tagcctcaat gactaagagg ggaaatgtga agttgtccag atgattcgca    218220
     tttccaagtc ttgtgcttca aatgtatgca tggcggcttt caagtgatgt aaaagctttc    218280
     ttggacgtta tgaaatattt ggggcgcctt catcgcccgc atgtgaccta tgccgccgtg    218340
     gcaagcgcac acggataagt ccacgtaccc gccgaggagg tcctggcctg atccggacgg    218400
     caagtgcctg gcgccatcat gtatggtctg cttccaggca tcgatttcct caatgtatcg    218460
     actcctgtct ggacgctttc gcctccccct cgagctgctt gcgcagcgcc gcgaagcgct    218520
     cctgtatatt ttctccaaac agcggatctg ggctgtctgg aacggtggtc gcgacttctg    218580
     cccagtcctc ttcggtcagc tgctgcgcag cgcgcggcat gacgtgtctc tcctcagtgg    218640
     agagatgatt gcgatagtac acaagataca tggccgcggc ggcctccagg gccgcgcgcg    218700
     aagtgatgac atctcgctcc gcttcattca gacggcttag gagctcttcg cgcaccctgg    218760
     caattatgcg atgctcttgc aggagccggc tgaccacaat ctgcatgccg ggatctcgct    218820
     cgacgagcag tgcgtacgca acatcctcgc gaggatggtg aacacgatca ccaaagttcc    218880
     gcatgtaata gatgatcgtg ccgatcaaac tgtagttcgg ctgctctccc cggtgaaaaa    218940
     cgctcacctg ctcttccagc aggtcgagca gtgcggcgaa attgatgtga tcggcatgcc    219000
     aaatggcaag ttggtcggtc atggcgcgct ccagcgaaac tggtcaagta cacgatcggg    219060
     ctcgaagctg tatcgaactc aagaggctct aatctgaaca gtagtctccc gttaccattt    219120
     ggggctgatt tagatcaata gtgggcgtcg cccactctcc cacacgcctg tgtcggcaca    219180
     atgggccctg ctcgaacccc ggcatgacgc tcttgcgctt ctgggctgcc atggaagggc    219240
     gcctcccagt tgccccagca cgatgcgcac gatgcgctcg acatgcgcgc cggtcagctc    219300
     gatgcgggcg ccggccagtg gtcactactt ggtcacgatc cttcgatgtt gccatggcgg    219360
     ccaccgcttg cgaggcgggt gcgatgcctt ctggtgggag atgctggccc agtggcgcaa    219420
     gactgggctg agcatccgcg ccttctgtca ccagcatggc ctggtggtca gcattgttgg    219480
     cccatggcgc aagcgcgtgg accacgaccg gccgggttgc cgctgacggt gaccgccgac    219540
     accgccttca ttgcggcagc cacgagcaca gctgagatgg tgatcacctg ttgcacggac    219600
     ccatagtaca gtcatcccgg cgtcattaga attagcagca aatagccttg atttctcaac    219660
     ggtatggcct acctcgtcaa tttgaatgtc atgcgacatc ccagaatccc gtattgtcga    219720
     gctatgaagc gcaagtgagt aggcccagat tacgctcgaa gatccgctgc ccgtgcgtga    219780
     actcctgctg cgggcccgcc gcaaaaaggc tcatgttcgg tcgtgctacc gcttcgcaga    219840
     tcgcctcagc atcggccgca tcgttccttt tggtcttaac gtacggtttg acgaattgcg    219900
     gcgccagcat gggtgaggca tatcaaatct gcatcttact caagatgcga tgtccttgcg    219960
     accagtaata tctatgtatg attttcagcg gttggcatta tgcttgcggt ggcagtacag    220020
     actgtttgca atggcattat cggctctgtg gcacacgttc ataacgtcga ggttctcttg    220080
     tgtttcgcac aagtagtttc gattgttgac gacgatgagg ctatgcgcat cgcaacggcg    220140
     agtcttgtac gctcgttcgg aaaacctaca cgccaatttg cgtcggcgga ggagttcttg    220200
     caatcgggcc atatcgccga gacatcgtgc ctgacgtcat gatgcccggc atctcggggc    220260
     tcgccatgca cgaccgcatt ctggcacttg gctatgcgcc gccgaccata ttcatcacgg    220320
     cattcccgtc ggccgacctc caagcgaatg cccttgccaa aggcgcgctg gctgtcctca    220380
     aaaagccggt agatgctaac accttggcgt attggctcag tgtcgctttg tgcccgccgt    220440
     agcggatcga cgatatgttg gacagcgcga gcgcaagact gcgctgccga ggctggcatc    220500
     gagttgattg atggcgactg ccagacgccg actcgtgcgg cttgcggcgc aaaaatggcg    220560
     ccacgaaagc ggaaggaaag tccgttctgg ggctattgca acccccgagt tgcctgacga    220620
     cacttgcctg tgcggcgcta tccggaaatg attggtcgat gaggaaggaa aggacatctg    220680
     cgaatcgatg tccttccgct ctactgaaag cccggacaac cgatcttcac caagtcggcg    220740
     gcgaccggaa cgaccggtcc ctgctactca gcaaacaggt cgggaccaaa cacttcgtaa    220800
     tgaatgcgtg cctcatgaat gccgagattc ttcagggcat catgctgcat tcgcatgaac    220860
     ggaatcggac cgcagatgta gtagtcggcg tctggcagca ggatcgattt ctcgatctgc    220920
     ttcacatcga ctaagcccgg ataatcatag tcccgtccct ggacatcttc cggtagcggt    220980
     tggtcataga aaacaaagag gtcaaggttt tcataggtct tcgccgcttc gcgcagcctg    221040
     tcgcgcatcg cgtgtactgc gctgttacgt gcgccatgca cgaatacaac ttgcctcggt    221100
     ggggcctgca atgccacttt gagcatgctg accatcggtg tcagcccaac gccaccgctg    221160
     atcaggacaa tgggtgtctt ggcgtcaacg tcgatatgga agcttccata gggcgcagcc    221220
     agcttgacct gatccccaac attcacgtga tcatgcaaca ggttcgaaac atagcccgga    221280
     ggctgcggcc cgccgccctc gcgcttcacc gagatgcgat agctgcgccc gttcggcata    221340
     tccgacaggc tgtattggcg aatctgctgc aacccgagcg cgggcacatc gattgcgacg    221400
     ctggtgtatt gtccgggttc gaagttcacc acgggaccac catcggcagg ctcaaggatg    221460
     aatgacgtga tcacatcgct ctcggggcgc ttctcacgaa tcacaaaggt gcgccacccc    221520
     ttccagccac cgggttgttc cgcagagcgc tcatacaact cgctctccat gcccatcagg    221580
     acatcggcca gattcccgta ggcttgcgcc caagcggaaa tgatgtcgtc ggttgcggca    221640
     ttgcccaaca cttccttgat ggcggccagt aggtgttctc caacaatggg gtactgttcc    221700
     ggtttgacgc cgagacttgc atgcttgttg gcgatgttct tcaggacggc catcagactg    221760
     tttgggtcct cgatattctc cgcataggca tagaccgccc gtgccagcgc ctgctgctgc    221820
     tggccctgtt cctggtgggc catgttgaac acattcttca gttcgggatg cgcttcgaac    221880
     atgcgctgat agaagcactt gatgatgtcg tagccgtgtt cggccagcac cggtgcggtg    221940
     gcctttacga tgtcttttgt tttctgggtc agcatagtcg gtctccatgg cgcgggcgta    222000
     ggggtcgcca aatcggcgag ggtagacggt ggcctgcctc gccgcgttga tcaaggtcaa    222060
     gtctaggtga gacggtcgtg acggagtaac ccgaagccgt gccgcaaggc ttgaacgatg    222120
     acactcatgg cagaaattga acgggccatg ccaagatacg gcgaatccgc tatcacaagg    222180
     tctatcgccc ctgactgatc cgctattgaa gctgggataa gcggcggcgc aaccccgacg    222240
     gcgctatcct acgcgaaaaa actccacgct ctgtcccgca ttgacccgtc gtgcgcctgc    222300
     cgcgcctcgg ccagttgcgc cgagatcgcc gcgacctctt cgcgcgcggc cgcggtctcg    222360
     gcgcgtgccg cgtcgcgctc ggcctcggcg gcgctggccg catggcgggc ctcggcgcgc    222420
     aagcgtggcc agctcgccgg tggccgctga tcacgttcca cgtcatcgcc aggcgcgtgc    222480
     agcgcttgcc ggcggcgata tggcggcgca ggttttccgc gtccagcggg tggcgcacgt    222540
     agcgcacggt ggccttgctc tcggcgccgg actgcagctc gatctcctgg tcgacggtga    222600
     agccggacgg tgcggcatcg ccggccagcc attgcatggc cgccaccggc gactggttga    222660
     cgtgcaggtt gcctggcgcc ccccggtcac tttaggttat tttccccagt acagtccaaa    222720
     aaagaaaaca cccgcatcgt ttgacggtgc gggcgaagtt tccattccgg aaacgggtag    222780
     acaagtcatg aagagcgccc ccgcatctcc atgacaggag caatcttatc gggcagcacc    222840
     cagccgcggc ttgaccaaag tcaagtgcgc agcagactgc ggcagcttaa ctgccctggt    222900
     gcgcaagtac gtcggccatc tcgtcggcgt gctcctcttc caccgccaag atctcttcca    222960
     tcgtgcggcg cgaggtcggg tcgcctcgtc caggaagtgg acgatttcgc gatagctgtc    223020
     gatggcaatg cgttcggcga tctggtcggg atgggcttgt tcctcgttgg aatgggccag    223080
     gaattcatcg gccacgctct tcgagctcaa gccgtcgtca tttctgcccc cgttcaagtc    223140
     tgccggcata cgggccgccg tcgcttctac atctcattga gttcaactca atgctgcttt    223200
     tgtcactttt cccaataact gagacggcca attgcgaaac atttgagata catcaatagg    223260
     tgatatatga ggtggccaca tgctgtgctt ggcaaaggcg gctcgataca tggttttacc    223320
     agtcgtattg aacagcatgc tgcgagcagc taacatgttc atcctgggcg cgatgacaca    223380
     agtgcccacc agccagacct ttgcgtccga gagcaaagaa gcggcctgta caagctatgc    223440
     cagctgtcac gaacggtaat gaagtcccgt agcactatta gaccaatagc ttaggagacg    223500
     actgtgctga gtcagcatga gtttgccacg ctcgtgctgg taagcgacaa ctctgaccca    223560
     acggagctgg accgcgcgga tgtggaggcg ctgctcacgc atcagctggt tgggcttcag    223620
     agctttgggc ccaaccacag ccgccctgga gtcacaatcg aagactatgc ttttctccaa    223680
     gccgtcgggc gtgttcgcgc aagggattgt tggccacgcc aggcctcgca gtgcgcgcat    223740
     tgctttaacc cgtagagact gccggcgttt ccactctcac gggcttccct agcagcaagg    223800
     accgcgaggt tcgcaatgct gcaatcttta ttcactcgaa gtccgctcca ctgggctctc    223860
     atcgaatagt tcaggggcgg gccgcactta ggagatgcaa gatgactcag tggacagcag    223920
     agcaatgcac caaggcacag atggcgggcc ttgaagccat ggccggacta accaacaagg    223980
     tcttggaagg gttcgaaaaa gtaatggatt tgaacctcca aacaatgaaa atgaccctgg    224040
     cgcataaccg ggagggcgta atgaaagccc tctcagtcca gaacccgcaa gaactcatcg    224100
     aattgcaaat cgaattattt caacctgcag ccgacaaagt tttggagtat cggcgtcaac    224160
     tgcacgacat ccttgctgct acgcgggcgg agttcgagaa gatcgccgaa gtccaataca    224220
     caacaagcaa gggccagctg cagggtctca tagatagcgc ggtgagcaac gccccatccg    224280
     gctcgacggc tccgctggcc gcctggcagg aggccgtaaa ggcgaccact gcgctctatg    224340
     agtcgatgca gtcgacggca aagcaggccg tggaagtagc cgagaacagt ttcaatacgg    224400
     ctgcggcggc ggcctcgaaa ggcgcgcggc atcgtgcagc gctggcgtct ccggcagctg    224460
     caaagtagtc cggcagcgct gggcccgcct catccatgcg gttataccaa gacatagggg    224520
     attggagaca tgaccaaaaa gcttgccgtt gtcacgggtg gtatgggcgg tttgggcgag    224580
     gccatcagca tctggctcca gggcactggt tatttggtgg ctgtcacccg ttctcccggc    224640
     aacagcggtg tcgcagactg gctcggctcg ggcggatgga ggagcaagac cgaaattcca    224700
     cttacccccg taccgagatt gatgccggcc aggaggccat gctgacgctg tcgatctaca    224760
     aaggtggtat tgccgtcaat cgcgatgccg agtggttcgc ggacgagtcc atctcgtaca    224820
     agacgctcgg cgagatctgc ctggcccagc caggcggcgt gggcttccag atctgtgagc    224880
     agaagatcat ggcccagtcg gcgccgcagc ccacgtcgaa caatctcgag gaagcctatc    224940
     gtcgaggccc ggtacgcaag gcagacgagc tggtgtcgct cggcaagtct gtcggcctcg    225000
     acggcgagcg cctgcagcag atcgttcagc gctacaacag tgacgtggcc aacggccgcg    225060
     acagcgtgtt cgggcgcagc ggcctttggc gtcgctgggg caagctcatc gccatcgaca    225120
     ccgcgccctt ctacatctat ccgtgcatca cagcgatcct ggcgacctac tgcggcctga    225180
     aggtggatgc agacatgcgc gtcatcgaca tccagggtgc gcagattccg cgactgcatg    225240
     ccgcaggcga agtcgtcggc ggcttccacg gctcgggcta catgagcggt tcgtcgctgt    225300
     ccgagtccgt catcttcggc cgcgtcgcgg ctcgcactgt gctggaggga gcatgaagcc    225360
     aacggttctg ctcatcctgg cgcatccgga caagcgcggc ttcggcggcg cgctggctga    225420
     ggcctacgtc aagccactgc aagcccaagg ctgtgatgtc gaagtcctac acctgccggc    225480
     catggagttc gacgccaccc cggccggccg ccccccggaa ctcgaagcgg atcttgtgcg    225540
     tgcgcgcgct gcgatccagc gcgccgtcac atcgcactca tttaccctac ctggttcggg    225600
     gcgatgccag cccggctcaa agggttcttc gagcgcgtct tcggcaacga cttcgccttc    225660
     aagttcaagc cgaaatcgct gttcccggag tcgttcctga ctggccgctc tgcggacatt    225720
     ctcgtcacca tggacacgcc accatggatc taccggttcc tgctgggtgc gcctggccac    225780
     aggctcatcc gccacgctat cctcggccct tccggcatcc gccccatcaa gatcatgact    225840
     ttcggtcccc tgcgcgcatc cagcgatggc cagcgacaaa ggtggctggc ccgagcccag    225900
     gcccgcgcca cgtcgatcgc caagcggctc aacgcagggg cccgtacgac gcctgcctga    225960
     gacacccgct ggacgttgtt tgaagtaatg ctcgctcgcc gccatcaacc gtccggcttc    226020
     aactgggacg cgcggtcgca aggcccgata tcgttcgcac cgcttcactt gtgctgccgc    226080
     gcagcatagg caggtcgacc agccaaatta gtgtgaattt cagcaagggc cgatattcta    226140
     gatttcccat gcctgcgttg gctcttgatt cgggcgacaa aaaagcctaa ggtggttttc    226200
     ggtgcgcgct cccagcgcta ctcgccccga tgcacccact gccgtcgcca tcgtcctccg    226260
     tggaactcga gccacggagc agcagtcgta gttcctttgt ccacccacga caaaggaggc    226320
     cgacatgcta agtccgcatg aaatcgccgc gctactgctg cttgacgatg cgcaggagat    226380
     ccacgacctc gaacccgagc atttggacag cttgctggtc cacaaactgg tcacgttgga    226440
     gcatggtcat gataccggca atgcctaccc ccgcctgaca agtcaggggc attccatgct    226500
     cgacgccgtg cgccgcatcc ggtaacagtc ggctcgtgcg ggagagcaaa cttcacgcgt    226560
     aatcgcggct cagggctgat atgaccgttg tcaatcgaga tcggtttgtt tcagtttctc    226620
     agttgcatgt tgtcctaaat tgcaacgtag ccgtaaatct cgacggtgga ttacgctgat    226680
     atccgcggat tggctaccgc attacagagg tccaatgagc ctgccgctat ctaaagccgc    226740
     gagtcggatg aaatccgttg cgtagccctg tcgcgggcta ctcgggtgcc gggctacgcc    226800
     gccttcagga aactgcctcc aaggtatgtg tcaaatatgt cgatactgca gcgctcagtt    226860
     acgttgcccg cgcctcgtgt ggtacggcga gcgacatcgc gagccggctg atgtcccaga    226920
     tgaacccgct cagttcgcgg gccactgcga ccaccgccat gttcgggatc tttccgcgcg    226980
     cagcgagctt ccgatagcgc cggcacagta gaacctgggc gtcccaggca cggtcaagga    227040
     tagctttggg gatgcgttcg tgcctgcgct ggatctcggg actgacgcgt gcaggtaccg    227100
     gtaactccgg gctgcctcga ccagcagctt tctggcatag ctgttgccgt tcttggtgat    227160
     gctgccctga cgccgtttgt cgcccgatga gtgctcggag ggcgtcacgc cgagccaagc    227220
     catgagctgg cgcggatgcg cgaagcgcga gagatcggcg atcggcgcgt tcatgttggc    227280
     ataatgcacg tgccgcgggc gtcgcaggcc tcctcgatag agcccatccc tgcatgctgg    227340
     ggcgtggaac acaagcgcga ggcgcgtgcg ccggcactca cggccgggtc ttgacgactt    227400
     taccggactt gctggagggg acagataaag agcacccaac tgttccgcat cgcacaacga    227460
     cgcagcctcc ggccggtcgc ccgccagatc cgccaagtgc tgcatcgagt gctgtcttga    227520
     caccttgtcg ccggcttcct ttaatgggtt acgtgtatca aggtgcttta tctgacaggt    227580
     tcggccgaat acctcaagcc atgatggaat ccggggaagt ccacgatccg cagcgcaaga    227640
     aggaagaact gcgcagcttc ctgttcctca ccgccgtgat ggtgccggtg ctgtcggtca    227700
     tcgtcgttgc cggctacggg ttcattgtct ggatgagcca actggtgggc ggcccgccct    227760
     cgcactgaca ggcgcccgcc aggcggcggc gtcaccggta acaagcaaaa gaaggtgaag    227820
     cggcatttag ctggaggttc cgcatgccga ctgcgaagcg tgccatcccc atacagccac    227880
     tcccatgcgg cgaggagtgg catatcgccg gcatcgtggt gcacaccctt cccgacagcc    227940
     tgccccaggt gcgagcggcc attgaggcca taaccggcgc cgagatccac gcggtcagcg    228000
     acgacggcaa gctggtcgtc accgtcgagg cgcccacgtc gcgcgccatt gccgcacacc    228060
     tcacctgcct ccaccagttg gagggcgtgc tctccgccgc gctggtctac cagcacaacg    228120
     aagacgccgc agcgatgaac gaggagatgg ccgatgaaga tctctcgtcg tgatttcatc    228180
     aagcagaccg cgatcacggc taccgcatcc gtggcaggcg tgaccctgcc agcgggggcc    228240
     gccaactttg tcacagacag cgaggtgacc aagctgaagt ggtcaaaggc gccatgccgg    228300
     ttctgcggca caggctgcgg cgtcaccgtc gccgtcaagg acaacaaggt ggtggccacg    228360
     caaggcgatc cgcaggccga ggtcaacaag ggcctgaact gcgtcaaggg ctacttcctg    228420
     tccaagatca tgtacgggca ggaccggctc accaggccgc tcatgcgcat gaagaacggc    228480
     aagtacgaca agaacggcga tttcgcgccg gtcacctggg accaggcgtt cgacgagatg    228540
     gagcgccagt tcaagcgcgt gctgaaggaa aagggtccga ccgcggtcgg catgttcggc    228600
     tccggccagt ggacggtatg ggaaggctac gcggccgcca agctctacaa ggcaggcttc    228660
     cgctccaaca acatcgaccc caatgcgcgg cattgcatgg catcggccgc ggccggcttc    228720
     atgcgcacct tcggcatgga cgagccgatg ggctgctatg acgacttcga ggccgccgat    228780
     gccttcgtgc tgtggggctc gaacatggca gagatgcacc cgatcctgtg gacccgcgtc    228840
     accgaccgcc ggctgagcca ccccaagacc cgcgtggtgg tgctctccac cttcacgcac    228900
     cggtgcttcg acctggccga cattggcatc atcttcaagc cgcagactga cctggcgatg    228960
     ctcaactaca tcgccaacta catcatccgc aacaacaagg tcaacaagga cttcgtcaac    229020
     aagcacaccg tcttcaaaga gggcgtgacc gacatcggct acggcctgcg cccggaccat    229080
     ccgctgcaga aggcggccaa gaatgcctcc gaccccggcg cggccaaagt catcaccttc    229140
     gacgaattcg cgaaattcgt ctcgaagtat gacgccgact acgtcagcaa gctgtcggcc    229200
     gtgcccaagg ccaagctcga ccagctcgcc gaactgtacg ccgaccccaa catcaaggtc    229260
     atgtcgctgt ggaccatggg cttcaaccag cacacgcgcg gaacgtgggc caacaacatg    229320
     gtctacaacc tgcacttgct gaccggcaag atcgccacgc cgggcaacag cccgttctca    229380
     ctgacggggc aaccctccgc ctgcggcacc gcgcgcgagg tcggcacctt ctcgcaccgg    229440
     ctgccggcgg acatggtggt caccaaccca aagcatcgcg aagaggccga gcgcatctgg    229500
     aagctgccgc ctggcaccat ccccgacaag cccggctacg acgccgtgct gcagaaccgc    229560
     atgctcaagg acggcaagct caacgcctac tgggtgcagg tcaataacaa catgcaggcc    229620
     gccgccaacc tgatggagga agggctgccg ggctaccgga atcccgccaa cttcatcgta    229680
     gtgtcggacg cctaccccac cgtgaccgcg ctggccgccg acctggtcct gcccagcgcg    229740
     atgtgggtcg agaaggaagg cgcctacggc aacgccgaac gccgcacgca gttctggcac    229800
     cagctggtcg atgctccggg cgaggcgcgc tcggacctgt ggcagctggt ggagttcgcc    229860
     aagcgcttca aggtggaaga ggtctggccg cccgagctga tcgccaaaaa gccggagtac    229920
     aagggcaaga ccttgtatga cgtgctctac cgcaacggcc aggtcgacaa gttcccgctc    229980
     aaggacgtca acgccgaata ccacaatgcc gaggccaagg ccttcggctt ctatctccag    230040
     aagggcctgt tcgaggaata cgccaccttc ggccgcggtc acggccatga cctggcgccg    230100
     ttcgacgcct accacgaggc gcgcggcctg cgctggcccg tggtcaacgg caaggagacc    230160
     cgctggcgct accgcgaagg cagcgaccca tacgtcaagg ccggcaccgg cttccagttc    230220
     tacggcaacc ccgacggcaa ggcggtgatc ttcgccctgc cctacgagcc gccggccgaa    230280
     tcgcccgaca aggaataccc gtactggcta gtcaccggcc gcgtgctgga gcactggcac    230340
     tccggatcga tgacgcggcg cgtgccggag ctttaccgtt ccttccccaa tgcggtggtg    230400
     ttcatgcacc cggaagacgc gaaagcgttg gggctgcgcc gtggcgtgga ggtcgaggtg    230460
     gtgtcgcggc gcggccgcat gcgctcccgc atcgagacac gcgggcgcga cgcgccgccg    230520
     cgcgggctgg tgttcgtgcc gtggttcgac gccagccagc tgatcaacaa ggtaacgctg    230580
     gacgctacct gcccgatctc gctgcagacc gacttcaaga agtgcgcggt caagatcgtg    230640
     aaggtatagc gtcggtcgag accaagaaca gggagacgcc atgaagccaa gccgatcctg    230700
     ggcaagcctg ctggccgtct gcgcggtgct gctggccgcg ctggccatgc aggcgatctt    230760
     tttccccgcg cccgcgcgcg cgcagggcct ggtggatgcc atgcgcggcc ccaccgccat    230820
     cgccaacgag ccgcgcgccc cgctgctcta ccccacagag aacaaggaca tccgccgcac    230880
     gcgcaactac accatgcagc cgccgacgat cccgcacaag atcgacggct accagctgga    230940
     caaggacttc aaccgctgca tgttctgcca cgcgcgcacc cgcaccgaag agacccaggc    231000
     gatcccggtc agcatcacgc actacatgga tcgcgacaac aacgtgctgg ccgatgtttc    231060
     gccgcggcgc tatttctgca cccaatgcca cgtaccgcag gccgatacta agccgctgat    231120
     cggcaacaac ttcgtcgacg tggacaccat cctcaagcgc aggcccggcg ccaagggcgc    231180
     cgccaaataa aacgaacaaa gtgggtacgc catgctcgac ctgatcaagc gctactggcg    231240
     gacgatcaac cggcccagcg cctatttcag cctgggtttc ctgaccctgg gcggcttcat    231300
     tgccggcgtg atgttctggg gcgcgttcaa cacggcgctg gagctgacca acaccgagca    231360
     gttctgcacc ggctgccacg agatgcgtga taacgtctac caggagctgc agggcaccat    231420
     ccacttcacc aaccgcagcg gcgtgcgcgc caagtgctcg gactgccatg tgccgcacaa    231480
     ctggaccacc aagatggcgc gcaagatgca ggcatccaag gaggtctggg gcaaggtctt    231540
     cggcaccatc gacacccgtg aaaagttcca ggcgcaccgg ctcacgctgg cccagcacga    231600
     gtgggcccgc ttcaaggcca acgactcgct ggaatgccgc aactgccacg actaccagtc    231660
     gatggacttc acgcggcaga gcccgcgcgc acaggccatg cactcgactt atctagccaa    231720
     caaggaaaag acctgcatcg actgccacaa gggcatcgcc caccatcttc ccgacgtgtc    231780
     caaggccggg gagaaatgac acgtgccagc ccgctcgccc gagccgttgc ctgatcattc    231840
     gtcggtctgc tcgcccggct gcgcagacct tcccatcctt gccgccagcg ggctcggctt    231900
     ctcccgtgcg ggacgggtcg tgttcagcgg catcgatctc gctctcggcc ccggcgatct    231960
     actccaggtg ctgggcgcca acggcagcgg caagaccagc ctgctgcgcg tactgagcgg    232020
     cctagtggct ccggacgagg gcgaactgca ctggcgcgga cggccggttc gcgccggcga    232080
     cccgtccttg ctgcaggcgc tggcctatgt cggccacgcc aacggcatcg atcccgaact    232140
     gagtcccgtg gagaacctgc gcttcgccgc acgcctggcg ggcgtcgccg ccacacccga    232200
     caacgtgcag gccgcgctgg ccgcgttcgg gctggagcgc gtcatgcatg cgccggcgcg    232260
     gtcgctgtcg caaggcctgc gccggcgcgc ggcgctggcg cggctggcgc tggcgcggcg    232320
     cgaactgtgg ctgctggacg agccggtgac gtcgctcgac gccgacgccg ctgcgcgctt    232380
     ccaggcacag ctcgacgatc acctgcgcgc gggcggcatg gccatcgtcg ccacgcacgc    232440
     gctgctgccg ggcgccagga ccttaaggct ggacgcccgg tcatgacccg caccctggcc    232500
     gccatcatca tgcacgacct gtcgctttcg tggcgacggc gcggcagcct gctcggcagc    232560
     gtggtgttct tcgtgatcgc caccagcctg ttcccgctgg ccgtcgggcc cgacctgcag    232620
     cagctgcgcg cccttgcgcc cggcatcctg tgggtggcag cgctgctggc atcgatgctg    232680
     tcgctgtcgc ggctcttctc gcaggagtac gccgacggca gtctcgatca gctgctgctg    232740
     tcgccgcatc cgctggcgct gctggtgctg gccaagatct gtgcgcactg gctgaccagc    232800
     gggctgccgc tgctgctgtt gacgccattg ctcgcccagc aatacagcct gccggcaggt    232860
     tcttcgtttc tgcttgcagc gtcgctgctg gtgggcacgc cggcgctcag cctgatcggc    232920
     gcggtcggcg ccgcgctcac gctgggcgtg cgcggcggta ccgtcctgct ctgcattctg    232980
     gtgctgcccc tgtgcgtgcc ggtgctggta ttcggcgcca gcgccggcgc cggcgccgac    233040
     gccgggctcg aggtgctgcc gcagttctcg ctgctcggcg cctgcctggc cttgtcattg    233100
     ttcctgtgcc cgctggccac cgccgccggg ctgcgcaccg ccatggagtc gtccggatga    233160
     gccccccgct caacccagcg catggcggca acgctgcgcc acctgcgctg cgctcccgct    233220
     ggctggccta cgccgcgcca gtccgcttct atccgctggc gggacggctg gcgccgtggt    233280
     gcttcgcggc tgccgccatc ttcctgctca ctgggctcta cgtcggcttt gccgtctcgc    233340
     ccacagacgc gcagcagggc gaggtctatc gcatcatctt catccacgtg ccggcggcgt    233400
     ggatgtcaat gttcatctac ctcgtcatgg ccggctactg cgcgctggcg ctggtgctgc    233460
     gcacgcggct gtcgtcgatg atggcctcgg cgctggcgcc cacgggcgct ctcttcaccg    233520
     cgctcgcgct gtggacgggc gccctgtggg gccagccgac ctggggcaca tggtgggtgt    233580
     gggacgcgcg cctcacgtcg gagctgatgc tgctgttcct ctacctcggt ttcatcgcgc    233640
     tggaggccgc catcgacgag ccgcgccgag ccgaacgcgc ctgcgcggtg ctggcactgg    233700
     tgggcgtggt caatatcccc gtcatctact tctcggtgca gtggtggaac acgctgcacc    233760
     agggcgcttc agtcagcctc accgcggcgc cgtcgatggc cgccaccatg ctcgccggca    233820
     tgctgctgat gacgctggcc tgctggatgt acaccatcgc cgtcgcgctg gtgcgcgtac    233880
     gctgcatcct gcgcgagcgc ggcgaggtgt ccgatgccgg ccacgcgccg gcgaatcccc    233940
     gggagaccac aacatgaact ggtccgcact gtcatccttt actggccatg cagcatatat    234000
     cgtgggcgcc ttcggcatgg ctttcgccct gctcgccatc gaactgttct tgcttgcgcg    234060
     gcgcgcccgt gccggcgcag gtcctcgccg atgacaccac gcaggcgccg cctgggtctg    234120
     ttgctcgccg cgctgatctg cgtcggcatc gccacgacgc tggtgctcaa tgcgttccgc    234180
     tccaacctgg tgttcttctt cagcccaagc caggtcgcgg cgcacgaggc gccggtggcg    234240
     cgcagcttcc gcctgggcgg gctggtggcg cccgggtcga tccggcgcga gggcgacggc    234300
     atgaccatcc gcttcatcgt caccgatacc gcgcggcagg tgctggtggt ctatcgcggc    234360
     ctgctgcccg acctgttccg cgagggcaaa ggcgtggtgg cgcgcggcaa gctggaagcg    234420
     gacggcactt tcgtcgccag cgaggtgctg gccaagcatg atgagaacta catgccgccc    234480
     gaggccgccg acgcgctgaa gcaggccgag caggtcaacc gccgcatggc cgggaccccg    234540
     caaggagcgc ggcaatgaat gccgaactcg gccatttcgc gctgatcgtg gccctgctgg    234600
     tcgcgatagt gcaggccgca ttgccgctgg ccggcgccgc gcacggcaac atcgcgtgga    234660
     tggccgtggc ccgtcccgcc gcgcgcgtgc agtgcgtgct ggtggcgctg gccttcggct    234720
     cgctgacatg ggccttcgtc agcaatgact tcagcgtgcg ctacgtggcg gcgaatgcca    234780
     acaccgccct gccgctgacc taccgcattg cggccgtatg gggcgggcac gaaggttcga    234840
     tgctgctgtg gacgctgatg ctcgggctgt ggtcgacggc agtttccttc tgcagccggc    234900
     agcggccact cgccgtcgtg gcgcgtgtgc tgggtgtgat gggcaccatc agcgccggct    234960
     tcctgctgtt cctgctgttc gcgtccaatc cgttcctccg cctgctgccg cccgcgatgg    235020
     aaggccgcga cctcaacccg ctgctgcagg acccgggcat ggtgtttcat ccgccgctac    235080
     tctatatggg ctatgtcggc ttctcggtca ccttcgcctt cgccgtggcc gcgctgctgg    235140
     caggccgggc cgacgccgct tgggcacgct ggtcgcgccc gtggaccacg gtggcgtggg    235200
     cactgctgac gctgggcatc atgctcggca gtgcctgggc gtactacgaa ctcggctggg    235260
     gcggctggtg gttctgggat ccggtcgaga acgcctcctt catgccctgg ctcgcgggca    235320
     ccgcgctgat gcactcgctc gcggtcacag agaaacgcgg cgcgttccgc gcctggacgg    235380
     tgctgctcgc catctttacc ttctcgctga gcctgctcgg cactttcctg gtccgctccg    235440
     gcgtgctcac ctcggtgcac gcgtttgcgg tcgacccgaa gcgcggcatc ttcatcctgg    235500
     cgctgctggg actggtcacc ggactgtcgc tgacgctcta tggatggcgc gcgccgcggc    235560
     ttgcacggcg cgtcgaattt tccgtggcag cgcgggaatc cctgctgctc gccaacaatg    235620
     tgctgctggc cgtcgccgct gccaccgtgt tgctcggcac gctctaccca ttgctgctgg    235680
     acgtgctcgg gctgggcaag atctcggtcg gcccggcgta cttcgagcag gtattcgtgc    235740
     cgctgatggc gcccgccgtg ctgctgatgg gcgccgcgcc gctggcgcgc tggcggcacg    235800
     gcggcctgcc cgacatggcg cgacggctgc gctgggcggc ggcggccagc atcgtcgtcg    235860
     gactcggcct gttgctggtt cagcgcaacg cgtcggcgct cgcagggctg gggctggtgc    235920
     tggcggcctg gtgcgggctc agcgccgtgg ccagcctgtc tacgcgcctg cggaaccagc    235980
     aaggccggcg cctggccgcc ttgcgccagc tgcccgcgag ctattggggc atgctgctgt    236040
     cgcacgcggg cgtgggcgtc ttcatcgccg gcgtgacgct ggtgtcgagc caggagagcc    236100
     tgcgcgaact gcccatgcgc gtgggccaca acatcagcgt tggcggctat agcttccgct    236160
     tcgacggcgt gacgcaggcg gcgggcccca actacgatgc gctgcgcgga acgctgtccg    236220
     tgtcccgcca cggcaagatc gtcgccgtcc tcgccccgga acgccgcatc taccgcagcc    236280
     aggacatgcc caccaccgaa gccgccatcg acagcggcct gacccgcgat ctctacgtcg    236340
     cgctgggcga gggcgtgggc gatggcggct gggcggtgcg catccacgtc aagccgttcg    236400
     tcgactggat ctgggccggg tgcatcctga tggcgctggg cggcttgctt gccgtctgcg    236460
     acaaacgcta ccgcctgcgt cggcgcgccc cggctccaca ggccgaaaca gtcgatgcgc    236520
     cgaaggcacc ggcactggcg ctttccaccg ccgaggagac gcgggcatga cgcgcttcct    236580
     gctgccgctc gcggctttcc tcgcactgac catcgccctg gcggccgggc tgcggcacga    236640
     tccgcgcgaa ctgccctcgc cgctggtcgg taagcccgcg ccggcgttca gcctgccgct    236700
     gctcgaaccc gaaggacgca cgctcgcggc ggccgacatg cgaggcaagg tctggctgct    236760
     gaacgtgtgg gcatcgtggt gcgccgcctg ccgcaccgaa catccggtgc tggttgactt    236820
     cgccgcccgt tcgcacgtgc cgctgtacgg gctgaattac aaggacgaaa ccggcgcggc    236880
     ccgcgactgg ctgcagcgca tgggcaaccc gtacgccgcg tcgctggtcg atgcggatgg    236940
     gcgagtgggc atcgattacg gcgtatacgg cgtacctgag acctttgtca tcgaccagtc    237000
     cggcgtggtg cgctaccgtc aggccggccc ggtcacgcgc gaggtgctgg agcgcaagct    237060
     gatgccactc atcgagcagc tcgagaaaag cggggacggc catgcgtagg cgattcggct    237120
     cattgctgag cgccgtgatc tgcggccttg cgttgcacgc cggcgccgcc acgctctcgg    237180
     acacggaact cgatgcgcgc gtccacgcct tgtccggcca gctgcgctgc ctggtctgcc    237240
     aaaaccagac cttggccgac tccaacgccg acctcgccgt cgacctgcgc cggcagatcc    237300
     gcgagcggct gcgcggcggc gccagcgatg aagccgtgaa ggactacttg gtgcagcgct    237360
     atggcgactt cgtgctctac aagccgccgc tcaggccgct gacctggctg ctgtggttcg    237420
     gtcccttgct gttggtggcc ggcgtgacaa tcgccatcat tcgcgcgcgc tcgcgcagcg    237480
     tcgcagccgg gctaccgctc gacgccgagg cgcaacgaca gctcgcagca ttgctggacg    237540
     agacgtccgg gcaacctgcc agtccgccag cggaggcacg acagccatga cgaccttctg    237600
     gctcctagcc gccgcgctga tcgccgccac catggcttgc ctcctctggc cgctgctgcg    237660
     ccaccgtgtc gcgccagatc ccgacacgcc ggagcgcgcc ctgctggcag acctgtaccg    237720
     cgagcaactg aatgagctgg ataccgacct gcaaagcggc acgctgaccg ccgcgcggca    237780
     cgcgggggcg cgcgacgaac tcgcccgccg cttgctggac gagaacgcca gcgccacggc    237840
     cgccgcacga caggcaaagc cttcgcccct gctcgccgcc gcgctgctgg ccgtcctgcc    237900
     cagcgctgcc atcctgctct acctgcacct gggcaatccc gtcgcgcaat ggagcgccaa    237960
     tgacatgccg gcggcgaccg acggccagca ccagctcagc ggtttgcagc tcgaaggcat    238020
     ggtcaaccag ctggcaaagc gcctgcgcga tgcgcccggc gacgccgaag gctgggcgat    238080
     gctggcgcgc tcctacagcg tgatggagcg ccacgacgat gccgccgcgg cctatgcgaa    238140
     agccattgcg ctggcgcccg acgtcgcgcc gctgcgttcg gattacgcgg acgtgctggc    238200
     aagcctcaac ggcggctcgc tggaaggcgc gccgatggag cagatcggcc gcgcgctggc    238260
     actggatccc gatgatccca aggggctggc gctcgccgcc agcgctgcgg cggaacgcgg    238320
     agacacgcag ggtgcgatcg gctactggga acacctgtac cggctgctgc ctgcggattc    238380
     gcagacggcg gcgagaattg cggcaaatct tgcggcggcg cgagggactg cggccacctc    238440
     gcttacggcc agcggcgaaa tcggcggcat tgtgacactc ggcgagatgg cgggcaggat    238500
     tcctcggcct gacgaaaccg tcttcatcta tgcgcgcgcc gtggatggcc cgcgcatgcc    238560
     gctggcggta atcagacgga cagtgcgcga tttgccggcg cggttcacgc tggatgattc    238620
     catggcgctc gggcccgacc acaagctgac cggatatcca cggctaatgg tcgaggcccg    238680
     catttccgca agtggcaacg ccacaccaca ggctggcgat ctcgtcggac gcaccggtcc    238740
     ggtagctgcg ggcagccacg aagtgcaaat cgtgatcgac agcatagtgc cggatgcagg    238800
     gacggcaccg gccgctgacc gtataccgca ctagaagtgt cacgagctcg caatcgcggt    238860
     aggaataccg gttgcccggt acccaccggg tcgccgtggc agtcacccgc ttccgactcc    238920
     cacgtgtcgc acttgtcgaa atctactacg cgggctttgt cgcctcccgt tgtcacgatt    238980
     cggggtgctc gcagggctct ggagctgcct gacgtctaga tgagcccgcc ggcggatacg    239040
     gccatcgatg ccgagtaggc agaacaagag gccaactcca tgaacgaagt gacgcatact    239100
     ttaagcaccg aacaatcttg tggacttgat cgcgagcaaa ttaatgtcaa tttatacaaa    239160
     ccgccaataa tatgaattga atgcatgaaa gatccagaaa atgatcattt tttcactggg    239220
     agctcctgcg atagagtcgt gatcggaagt cgatgaacga ccgagcaagc caatttggtt    239280
     accaagatcg ggataagcgt cacttccctt ccataatcta gcgagggaat cgtcatgcaa    239340
     ttcgagtaca cgccgaaggt caaggagatg caggccaagc tgctggcctt cttcgaaagg    239400
     cacatctatc cgaatgaaca gcgcttcgag gaggagatcg acgctaaccg ccgcgccggc    239460
     aatgcatgga ttccctccac ggtgatcgac gaactcaagc cgcgggcgcg cgaagccggc    239520
     ctgtggaacc ttttcctgcc gcgttcgccg cgcgccgcgc agggcctgtc caacctcgag    239580
     tacgcaccgc tatgtgagat catgggccgc gtgccctggt cggccgaggt gttcaactgc    239640
     tcggcgcccg acaccggcaa catggaaacg ctggagcgct acgcctcgga agaactgaag    239700
     gaccagtggc tggagccgct gctggccggt gaaatccgct cggccttcct gatgacggag    239760
     ccagccgtgg cctcgtcgga cgccaccaac attgcctgcc gcatcgagcg cgacggcgac    239820
     cactatgtga tcaacggcac caagtggtgg tcatcgggcg cgggcgaccc gcgctgcaag    239880
     gtctacatcg tgatgggcaa gtccaatccc gacgctgccc gccatgagca gcagtcgatg    239940
     atcgtggtgc cggccgacgc gcctggcgtt accgtcaaac gcttcgttcc cgtgttcggc    240000
     tacgaccatg caccgcacgg ccacatggaa atcgagctga agaacgtgcg cgtgccggct    240060
     tcgaacatcc tgctgggcga aggccgcggc ttcgagatgg cccagggccg cctgggccct    240120
     ggccgtattc accactgcat gcgcagcatc ggtgcggccg agcggacact ggaactgatg    240180
     tgcaagcgca gcctggaccg cgttgccttc ggcaaggaga tcgcccgcca cggcgtgacg    240240
     caggaacgca tcgccgaagc ccgctgcgaa atcgaaatgg cccgcctgct cacactcaag    240300
     gcggggtaca tgatggacac cgtgggcaac aaggtggcca aggccgagat cgccatgatc    240360
     aaggtggtgg ccccaaacgt ggcgctgaag gtaatcgact gggctatcca ggtccacggc    240420
     gcggccggcg tgtcgagcga cttcccgctg gccagctggt gggcgcacca gcgtacgctg    240480
     cggctggccg atggtccgga cgaggtgcac cgcaacgcca tcgccaagct tgaactactg    240540
     aagtaccgtt cggatcgctg aagcgtaggc gatttcttca agcctccccc gcgctaatca    240600
     cgttgtggcg tggggaggcg ctcatccatg gagccctttg atttccgtgt aacgcgtgcc    240660
     aagaacgtga gcatcaggtg accgatgcct gcgatgcttt agggaagatg agtgcgggga    240720
     cggcccctcg aagtcggatt gcaggagcgg gcttcaaacc gccacaagct gcgtgggtga    240780
     agagcccccg tggtgagcgt tgtcggaaaa gtcgggggca acctcggcag gtgggagtca    240840
     aagagacgaa cgcgagtgaa ccgctgatga cgtgccgtaa aaatcataat cgatgtcaaa    240900
     accgggggga ttgcatgctc cgggaaaatt ttgggcgatg cctgctgatg tcccaatcgg    240960
     catccggcat aaaggcggcg tgactttgat tcaggcttcg gtaaggaact ggggaatctg    241020
     tcgtcccgat gcgaagggag aaatccaagc ggaaggctcc gcaaggatga gtgcaccgat    241080
     gcggggggcg tacttgcatt aatcgaatct gaagacaaag tgactcccgt gatccggaga    241140
     tcaggcgatg cggacggatt gcgggcgtgc gagagccacc atgcggttaa gcacgcctac    241200
     gcggatcgcc acttctgttg attgcgaagc cgatgccacg cgcccaaagg cgattgacgt    241260
     tttgagccgg tacatcaggt tctcgatcag cgagcggcag tggtagccgc agcccctctt    241320
     ccattcccct cgccagtttc gcgcaatggc gtcaatggcc tcgttgcgcc actgcgcgcc    241380
     gggcgttctc tcagaccaag cgccgcccct tcgcgcggtg ggatcgaggt tgcgcgccgc    241440
     gggcttcgat ttgaggcgca tctcggctcc gacgccatgg ctggccagcc agcttgccag    241500
     gcgggccccg ctttcctcgt ccggttcgcc atcgctgttt gagacaacca cgatcgaaac    241560
     aattgaggca agccgaagca ttggcagcgc atcggcaaca gccctcgccg cctcagcctg    241620
     ccgttccacg caattgcgac acggcctcgc agttgcggcc aggcctttcc cggcaccagc    241680
     gacacaggcc gtccagcgtt cagcaacgcg tactccgccg ccttggccat gggcgccggc    241740
     acgttttcat ctgtggacgg cggcgtccgg aagaatgatg tcggcgaagc ggccttccct    241800
     ggcaagcgcc cagccctctt ctgcttcaac gacggcttgc ctgatcggta tcgacggtgc    241860
     cgcctgcttc accaggtctc gcaggacagc gtagtgctcg gctgcgagag cggcgtattt    241920
     tccggcctct tcaccagcgc cgcggtaagg ctccagttgc gtgccagtcg ccgtcagtcc    241980
     aacgatgctg ccgtcgaaca gcaacgcaag tcctgctgcg gcttcaatgc gtgcgtctcg    242040
     tgcatcgtct tccctgaggt cgacgagcat tgtcctgaag ttcattaaac ctcctgcaag    242100
     cttgaagaag aagcccggaa tgaccggaga cgggccttgg cggattgcat gcgaactgaa    242160
     gtaaacagcg attcacgcct gccagataac gcagcgcccc ccgccagtcg atctggtaag    242220
     actggcggta ctccggcatg gtggcggtcc aacggagatc ccgctcgatg tgctgccgga    242280
     gggcatcgct ggacttcggc tcgcggtgga cgacgaatga ttgccgcggc gtctggcccg    242340
     ccaagccagg tcaccagctc ggccgcatcg gcatgcgccg agagattctc gatctgctcg    242400
     accgtcgcgc gcacgacgat gtcctgcccg tggagccgga tgtcgcgctg gcccgcggcc    242460
     agtgcggctc cccgttccga ccgcctggaa gcccgacagc aggatcgtgc tgcgcggggt    242520
     cctgcccata cgccgcaagg tggtgcatgc gcccgccggt tgccatgccg ctgccggcca    242580
     ggatgatctt gggactgcga tcccggttca gccagaccga ctgctccatg ctctgtaccg    242640
     gcgttgccag gccgcatgca tcggcgcatg cagcgcggtc gatatgcagc tcttccggat    242700
     gcagcgagaa gatcgtggtc gcgtcgatcg ccatcgggct gttgaggtag accggcactt    242760
     ccggaatccg cttcagctcg cgcagcctgt gcaggcaata cagcaagctc tgcgtgcggc    242820
     ctaccgcgaa ggcaggaatg atcaggctgt cgccgcgccc gatggtccgg ctgatgattt    242880
     cgccgagtat gccgatgggg tcgccgccag gatgcagccg gtccccgtag ggcgactcga    242940
     ccagcaagta gtcagcctgc ctccgcttcc ggcgcgcgca tgaccaagtc atgctggcgc    243000
     ccgaggtcgc ccgagaatac gatgcgctgg ccttgcgcga gcagcgtgac gatggccgac    243060
     ccgacgatat gacctgcccg gctgaactcc gcttccacac cgggaaccac cgtgaagtgc    243120
     tggccgtagt gcgtcgggcc cagccggcgc agtgcgtgtt cgacatccgc actggtgtag    243180
     ggtggcaatg tcggccgatg gcgcgagaat cccttgcggt tggcgtaggc cgcatcttcc    243240
     gccgccaggt gcgcgctgtc aggcaacaga atgccgcaaa gctgcgcggt acccatcgtg    243300
     caataggcgc tgccccggaa cccgttacgc acgagcagcg gcaggtaacc gctgtggtcg    243360
     aggtgagcat gagtcaacac caccccatcg aggctcgcag gatcaaccgg gagcggatcc    243420
     cagttgcgca gccgcaaggt cttgtacccc tggaacaagc cgcaatcgac catgacgcgg    243480
     tcgcgcccgg tgtcgagcac gtacctggag ccggttaccg tatcggtcgc ccccaggaat    243540
     tgcagttgca tgccggcgtc ctcatatcaa tgcgagagct gaatcacaga cccagtctag    243600
     gggcagcacc acaggactgc gattgatcca ggtcgacggg ctggcgcacg gcgggaaggg    243660
     agctgccgaa tggctcaggc ggcagtccgc tgcaggcagg ccaccaccca cgaagccccg    243720
     gtggaaagcg ccagcccgat gccgacaggc aaggcaaacc tggcgccgcc cgtcagggca    243780
     gccgcgacga tcttgctgac cgtattggcc gtcaacgcgc cgagcaccgg ccatatcgac    243840
     gcgtggtcat ccagctttcc ggctcccacg agcgccccga tcgatgtcgc cgcggcatgc    243900
     gcgtccgcga agccggcccc gactgccagt gcaagtaggc cgtattgccg ccccaggcct    243960
     gtgtcgcggc ccccaccagc tgcaggacac caaacagcag cgcaaagcca cccgctccgc    244020
     gccagtcgaa cgagcggccg gctaacagcc cctcgccggc tgccggcgtc tcgcgcagcg    244080
     cccgccacag ccagaccccg ccacaggccg cgatcgccag caggcccgca gccagcggca    244140
     gtgccagcgc ctgcaaggcg gaaacgctag tggcgccgag cagcagcgtt atctggatga    244200
     aggtagcgac ggtcgacagc aaggccgccg cgacggggcc gtggaccggg ctgtcggcct    244260
     tgcgtgcccg caccgccatc gcgccgatcg tggccacgct ggaaacaaag ccgccgaaca    244320
     ggcccgtcat gggcagcccg aagtgctcgc cgaacatgcg cgcgaaaata tgccccgctg    244380
     cccggccagc agcaccagca gcacgaccag ccagagcgca tgcggattcc aggcgtcgag    244440
     cggccccatg tagcggtctg gcagcagcgg ccagacgatc agggctgccg cagccaggat    244500
     cagcgcatcg ctcatttcct ctcgggtgac gacgttgcgc gcgatgtgat gcaggaacgc    244560
     cttgccatgc agcaagagca ccacggcagt ggcaaagccc gccgccagca ctgcgtgcgt    244620
     cactgtcaac gcgcccagca ggatggtgag cagaggcgaa ttccgtagtg agcccggcgt    244680
     cccggttcgc ggatcgctgg tagctgatcg ctgccagcac cgttgcgccc aacaacgcga    244740
     ggggcagcag cagccgatca ggcagcatcg cgcagatggc gcccgacagg ctggcgacag    244800
     caaaggtgcg caaccccgcg ggatcttcgc cgccgtcggc ggcggactgg ctgcgttcac    244860
     gctccagccc gatggcaagc ccgatgccaa gcgccactga tacggaaagg atcagggggt    244920
     ccatgcccag tcctcaagtc gcgcggtcgt cacaccagtg aatccagtat tggccactat    244980
     cggaaactct gccacgcccg ccgctccggg ttgatgcatg tcaagcgcgt attactgccc    245040
     ggggggtacg ctgaatacaa cgaaacgcaa aaaagatcgc atactcatca ctacccgtga    245100
     gaagacacat catgtaccag cgcatcctgc tcgccgtcga cggcagccgt tcgtccgacc    245160
     tggcgctgag ccaggccatc atcgtcgcga aggcgaccgg ggcggaggtc aaggcgctgt    245220
     tcgtgttgga cgacagcgat atctacttcg agaccagcta cttcgacccc aaggaattgt    245280
     tggacaacat catggcggat ggccgcaagg cgctggacgc cgccacagcc aggctcagcg    245340
     aggcgggcgt cgggaacacg gcgcagctgg tggagaagcc ggtgtcgccc ggccggatct    245400
     cgttgacgat cgtcggcgaa gccgatgcgt ggaatgccga cctgatcgtg ctcggcacgc    245460
     acggccgtcg cggcgtcagg cgcttgctga tgggcagcgt gtccgaaggc gtgatcgcca    245520
     ggaccagcaa gccggtgctg ctggttcgca gcgaaaccga aggctagcgt ggcgcccgca    245580
     caatgacgga gcatcgcgct atggcccaga ccatgcgagc catgatcttc gagggcgcag    245640
     gactgccgct gcgcctgcag gacgtgccgg ttcccgaccc ggggcccggc gaggtgtgca    245700
     tcgccgcggc tgcatgcgag gtgtgccaca ccgacctgca tatcgccgac ggcgacctct    245760
     cccaccccaa gccggcgctg atcccggggc atgaagccgt cggccaggtc gaatcgtgcg    245820
     gcaccggtgt cacggcattc tcgcccggcg agcgcgtagg cgtgccgtgg ctgggaaata    245880
     cctgcggtga ttgccgctac tgcatgcatc ttcacgggaa cctctgcgat gcgccgcagc    245940
     tcaccggata cacgcgcgat ggcggctacg cggaatacgt ggtcgccgac agcagctact    246000
     acttcaggat tccgcccgcc tacgacgacg aacatgctga gccgctgctc tgcgccggcc    246060
     tgatcgacta ccggacgttg cgaatggcgg gcgaggccca gcgcatcggc atctacggct    246120
     tcggcgccgc ggcccaccta gtgacacaaa ttgccgccgc acaaggccgt gaggtctatg    246180
     gcttcactcg cgcgggcgac accggcgccc agcaactggc ctacgagacc ggcgcgtgct    246240
     gggccggctc cagcgacctc cagtcgcccg tggcgctgga tgcggcgctt atcttcgccc    246300
     cggtgggtgc gctggttccc tgcgcgctgc gcgccgtgga caagggggag cgctgtcgtc    246360
     tgcgccggca tccacatgag cgacatcccg cgcatgccct accagctgct atgggaagag    246420
     cgtcgcctgt gttcggtcgc caacctcacg cgcgccgacg gaattgcgtt gatgcagatc    246480
     gccgtccgga cgccgctgca gacgcacacg accgcctacc cgctcgagca ggccaatgcg    246540
     gcactggccg atctgcgcga ggggcgtctg tccggtgccg ccgtcctgag aatccgtcac    246600
     taaggcttcg gcagatatcc ccatgagccg ttaccagaca cgtttccaga cgcgggagca    246660
     ggccggcacg gagctggcgt tggcattgcg tccgtaccag gggaccggcg ccctggtcct    246720
     ggcgattccg cgcggcggcg tgccagtcgg gcgcatcgtc gccgattcac tgggtgccga    246780
     cttcgacctg gtgatggcgc gcaggatcgt gccaggcatg gcgctggacg aatccggcgc    246840
     gacatggtgc acgtacgaag ccaacgcgga cggcgcgacc gacagccagc gtgacgccca    246900
     gttcgaccag ctgcgccggc agcgcgcggt ctatatggcg gttcgcaaga ttgcggaccc    246960
     gaaggggcgc gtggtgatcg tcgtggatga cggcctggtc agcggcgcga ccatgtacgc    247020
     ggcgttggcc ggcctgcgca agcggcgccc cgcccggctc atctgcgcaa tcccgatcgc    247080
     cgccagggcc gggctggatc gggtccgcgc cctggccgac gagatcgtct gtctggatac    247140
     gccggatcgt atcgagaacc tagcgcactt ctatcgcgag ttccagttgg tcagcgacga    247200
     ccgcgtcaga caattgaccg cgatacagcc agcccaatcc caggctcgct cccggccagg    247260
     cgccgtggtg cgcatgccat cgctcagcct tgccctgcaa attccttatg gcaccagccg    247320
     gctacccgcc atgctcgaat cggcgccgaa tccgatgggc gtcgcgctga tggtatgtgc    247380
     cggtggcgcg cagcgccgtg cggcccgcag ccaatacctg gcgcgcaagc ttcgggcgaa    247440
     gggattcgcc accatgcttg tggacctgca gcccgagagc agggacaatg acgccccaga    247500
     atcagaaatc gatgaccttg cgagaaggct aaaccaggcg ctgattttcc tgcgcgccag    247560
     gatgccgtgc gcaaagcttc cggcgggctt gctcagtacc ggtaccgcag gggcggccgc    247620
     gctgcgtgcg gccgcatgca gcgcggacct tctcggcgcc gtagcctgcg ttgcgggacg    247680
     cccggatctc gcgggcagtg caaccttgca gcggctggac atccccgccc tgctgatgtg    247740
     cgccagcggc gatgcgcaga acatccacat caataacctt gcattcgaac aaatgcactg    247800
     cctgcggcaa ctgcggctca ttccgaccag cggccgcgga ttcgaagacc gcaatgccat    247860
     ggaagacatc gcgacgctca cggcagactg gttcgggcgg cacctcgcaa ccgcgtcgcc    247920
     tcccagtctg gcatacgggg gacgacaaac acccccaaac atgtgacgcc gcattcattc    247980
     ccgtgcggct ttccccacct atactcagtg caggtgacgg cgccccggag tcacaggtac    248040
     ggtgaccttc agccggatat caagccggtg accgtcaaat tccacgactt gatagggtcg    248100
     cgtggccgag ggacttcccg cttcgtcatc gtagagcggc ggccccttca gatgtgaagg    248160
     ctccagccgc tcgagcagcc gtgtcaaagc tgtcccggct gatccgagtc gatagccgct    248220
     gtggttcggg cgttggcagt cgtactccgg aaggcgctca acgattcgtt gccgcgccac    248280
     attgattccc ggaggggacg cccttgccgc gcaagcatct tggctgacac ggccgcgtca    248340
     agcccacctt cccggcctgg atcgtaagcc ccgcccgcgg gtggccaacg tcctatcacc    248400
     taaggtctaa gccggagttt gatggttgta gtttgagtat ggcgattaat tgcattttgc    248460
     cccatgagta tggtcgaatg ggtagagctt gcggcctaaa ttgcggggct tgcggcatca    248520
     atcatcaacg attgcctgca gatcccggga agcgggccgt cgttcctgaa cgctggctta    248580
     ggatgcggga tcctgtccag ccgcaccttg cccggcccct cgtcgacact gaccacgcgc    248640
     tcaccggcgc gatccttcac cgtcaccggg gtgatctccg ccgcaaatgc gccggattcc    248700
     atggcctgct tcgcgcccgt caccgaggtc atggcaaatg ggtcctgcgc ctcgcggctg    248760
     aactggcact tcgccgcaca gtcctcgccg aaggtgccca tcgctcgccc aggccggtat    248820
     cgttgcgccc cctgagacca tacgctcata tcgagcacat cgagttctcg gcatgaggac    248880
     tcatcggcaa aactccaaca cgcaatcttc gctcacgacg tcggaactgc cgccgcgtag    248940
     cagcaacgcc aaagactggc cttgtccttg gtcgcggtag agggttgcac tacgggcgaa    249000
     gccacccatg aaccggcacc gcgccttctt gcattatctc aagaaggcgc gccccgcttc    249060
     gggcgatact tgatcaattg gcatcaggca actggagacg gcctggccca actggagtgc    249120
     gacaatgttc tctcccaccg ccagccttcc tggcttcgat tcaccaattg aactgctgct    249180
     ggcctgccat gagaaggtgc ggcggttcgc cggcttatgt cagagacttg agcagcacgc    249240
     ggcgctgcac ggcgcggatg atgaggcacg aaccgctgcc gccagcgtgc tgagatactt    249300
     ccagatagca gcgccgctgc accacgccga cgaggaggaa gacctgttcc cagcactgcg    249360
     cgagctgggt gacgtcagct taactgcgcg tattgacgag ctagatgccg agcatgggcg    249420
     cctgggtgat ttgtggtgct gcgtgaaacc ctggctggag gcgatgtcgc agggcgcaag    249480
     gcaccctgct ccaccagaac tcagcgcgtt cgccaccctc tatcccgagc acgcattgcg    249540
     ggaagagcgc gagatttatc ctgccgtcgt ccggctgtcc cgggatcgcc ttgccgagat    249600
     cggccagcgc atggcacaaa gaagaggcgc gcgctagtag cggcgcgcac cggtaaacac    249660
     cccttcgcgg actggaacct gaaccgggaa tggcttgacc ggcgtcaatc gcggcaggcc    249720
     agtccctcgt tagcattcct gcgtggacac acgctaccaa ggacgctacc atgcaagcca    249780
     attccccctt cctcttcgac gcgcgcagca ttgccaagcg ctttcgccat gccgcgattt    249840
     ttggtgctct tgaagcgctg ggcgaaggcg agtcgatgcg tttcgtcaac gatcacgatc    249900
     cccttcccct gatcgagcaa ttgcgccggc ggtatcaaga gcaacttcat attgcctacg    249960
     ttcagcacgc ggacggtgtc gtggtaattg acttcactgt ccatccggcg ggtaccgcgc    250020
     aaggatgcgg cagcggagac ggtacgggct gcggctgcag cggcggctga accttgccgt    250080
     catccgccgc attcagatcg tctggacacc cctcgctatt cgcagctggc ttgaccacgg    250140
     acaaaccggc ccaggccggc ctggggcaaa atactaatga ggccgctggg ctgcgggggc    250200
     gcgcccgatg acctcgacgt tgttgtcctg ctgaaagcct gtccgtacga actacgggca    250260
     ggcttttttc acaatcggcg agattgccaa cgcgccgccc cggcttgttc ttgatcaatc    250320
     cactgcaata agcctcaacg gcatgatcct ttataagata catttttaat ctatcttggg    250380
     ttccactatg tctcccgacg caagcggatg ctgaattgcc tcagcttccg gtgctgccat    250440
     cccggctgat gccaagggtc tatacgatgc gccttaccac catgaccgac tatgcgctac    250500
     ggctgctgat ctacgtggcg cggcatcctg aacggatgtg taccaacgac gagatcgcgc    250560
     aggcctacgg catctccagg gcgcatctgg tcaaggtaac gcacaagctg agccgacagg    250620
     gctggatcgc gaccgtgcgc ggcagaggcg gtggcatgca gttgtcgtct gggccaggaa    250680
     gcatcaatct cggcgacgtg gttcgcagcg tggagcccga tttcgatctg gtcgctggcc    250740
     tggccgacgg cagcgcccgc aagttcgcga gcgacgagca tctttgccgc gtcatggatg    250800
     gcgctcgctg gagtttcctg caatatcttg aaagctttac cctcgccgac ctgctggggc    250860
     gggcgttcac ggagccgccg cctgccgacg tagtgcacct tggcagaagc taaaaacgtt    250920
     gcccttggcg gcaatgtggc cgcgtaccgg cggcggcgcc tggtgaacgc tcaggactgc    250980
     ctgggatgct gcaccgcgct gactcgccat gcccgggctt gcggcagcca cgacggcgat    251040
     gaaggccagg atggcagcaa cgttgccgct cgcagccatg gccttgacgg ccggcagctg    251100
     gtgaccgaag ctcagccgtg cagccaggga gaggtgcagc acggcaagcg gcacatagaa    251160
     gctgttgccg aacttcagct tgatgcgcgt gatcgctggc aggatgacag gcgcatgcgc    251220
     catcaccatg ctgacgataa agcccagtcc cagcgcatgg agcgccgcgt cgcgccatgg    251280
     cagccctgcc gcggtgcccg cccacgccgc gcctgccacc agcagccagc catagcccag    251340
     cagcaagcag actgctatgt agcggctcaa gccgtggctg cgcaccgtcc ggcgcgcaat    251400
     atcgaagcgt gccagccaac tggtaaggaa cgccagtgag acgccataga cgacgccacc    251460
     gatcctgccc gcgttccctt ccagcgccga cccggcggcg cccagcacaa gccccgcaag    251520
     gatcgcgagc aaggccgctt gcgcgctcgg tcggcggcgc atcaggcgcg tcatttcaag    251580
     ccgctcggcg gccaccgtga caaccaggaa aatgaagtac caggcattga ccgaggtcac    251640
     ccagcggccc gacgccagcg ccacgttgcc ggccagccag gccacggagg cggccagcag    251700
     caaggccgtg tgggtagccg gctggcgccg cagcactgcc acgctgacgc ccacgaacac    251760
     caacgcgcct gccgccatgg cccacgcgcc cgcggcagaa gatcctgcca ccatgagtat    251820
     ggcgcccagc ccggatgccg ccggtgcggc gaaggcggcg agacggccga gcgccaccgc    251880
     gcgctcgatg ccgatgatcg tgccgaggaa gccgccggtc atcaatgccc catggaatga    251940
     atgcgcgtgc cactgcagat gatggtcgtc caccccgggc aataccacgc ctgcacgcaa    252000
     cagaccgccg agcatgcccg cgagcaatgc gaacacagcc agcaacaaca ctgccagccg    252060
     cggccaggtc ttgcgctggc gcccttgtat gctacaagcg accacgctca ccatcccatg    252120
     gcgtgcttcg cgctggcgct catgcgctcc ggcgtccatg cgggctccca gcataactcc    252180
     acttcaatcc cgtaccccag cggcatcacg ccctcaagct caagatgcac gtcatccagg    252240
     accatgtcgg ccagcggaca tgcagtggac gtcatggtca tcgaaacata gacgcctgcc    252300
     tcgaatacgg ttacggcgta gatcaggcca acgtcgaaga cgttcagcgc cagttccgga    252360
     tccacgacgc ggcgcagggc atccgtgata ggtgccagcc attgctcggg gccctggtag    252420
     tcaaatccgc tcgtcccgtt cgatgcttgc ctggagagca tgtgtcccct ttctttgatt    252480
     ttctgttatg cactttccat cgtagtactg gccacgcttt ctgcgtggcc agtacccgct    252540
     ggtcgattga catagcgcaa gggacctgca tcacgccttg cgcagcgtga aactgctgaa    252600
     gcgcgccgcc agcctgctga tatcgtcgcg gccaagcgaa gcgctcgcgc cgctgccgcg    252660
     gcactcctgc aacgcccagt gcttcacgcc aagggcggcg atgctctcgg ccagcgcatg    252720
     cagctcggcg atatcgaaca tgccggcgtg ccaggtggtg cggcactcgc ctgccacgtc    252780
     gctggcaacc cagtggcgca gcgattccca ggccctctcc ccgctgcccg gcacccgcgt    252840
     aatggcgtca tagcgatgta ggggcgcctt gaggtcgagg ccgatccagt ccagttgggg    252900
     caggatggcg ggcaggcgat cggggtacat gccggcggtg tgcagcgcga cctcgaagcc    252960
     tctggcttgt acgtcggcga tggcgccggc cagggccccc tgcagggttg gctcgcctcc    253020
     ggaaaacacc acgccgtcga gcaggccctg ccgcgcttgc aggaaggcca gcacgtccgc    253080
     ccaggcgatg ctggaaggcg cgcgggcatc cagcaggccc gggttgtggc aatagccgca    253140
     ccgccaaggg cagccctggc agaacacgac ggcagccagg cggccgggga agtcgatggt    253200
     ggtcagcgcc gtcatgccgc cgacgcgcaa cgatgccgcg tcgcgccggc gcccggccgc    253260
     ggcctcacat gcatcaggtg gcgatggcat ggggctccga gaagaagcgg cgctcgcggt    253320
     gctcgccctg cttgccgaca ttgaagctgg agaccggccg atggtagccc atcacacggg    253380
     tccagacctc gcagggttgg cgctcctcgt cgcgcagcgc tgcatggcca ggcaaggatt    253440
     gcgtgaattg cgcggattgg tcatggtgaa tcatggatgc actccttctt gagatgggtc    253500
     gaaaaaacag gaaaggacga tgtttcggca aagactggac ggccaaacac agagacaagg    253560
     aagcgccgga ggcgctactg catagagaaa tcccgcgcat tccataatgc atcgcactag    253620
     gcagcgagct ggtctcgctt gcgggcgagg atctcttcgt cgcagcgcgg gcagaacgga    253680
     tgctcgccgg cgaggtagcc atgtgtgggg cagatcgaaa acgtcggcgt cactgtgatg    253740
     tacggcaggc ggaagcgcgt cagcgcgcgc cgcaccagtt cgcggcaggc ctcgccgctt    253800
     gataggcact cgcccatata tagatgcagc accgtgccgc cggtatacct ggcctgcaaa    253860
     tcctcttgcc gcgccagtgc ctcgaagggg tcctcggtcc agccgaccgg cagttgcgag    253920
     gagtttgtgt agtagggctg ctcagccgta ccggcctggc ggatatccgg ccagcgcttg    253980
     cgatcttcgc gggcaaatcg gtacgtagcc ccttcggctg gggtagcctc gaggttgtag    254040
     aggtggccgg tttcctgctg gaaggccacg atgcgttcgc gcacgtgttc gagcaggcgc    254100
     agcgcgaagg catggcccca ctccgatgtg atgtcgtgcc gatccgcggt gaaattgcga    254160
     atcatctcgt tgacgccatt cacgcccagc gtcgaaaaat gattgcgtaa ggtgccgagg    254220
     tagcgcttcg tataggggaa caggccctgg tccatcaggt gctggatcag cttgcgcttg    254280
     ttctccaggc tctgcttgcc cagttcgagc aggcgatcga gagcgcgcag tagcgccgcc    254340
     tcgtcgccgg catgcaggta gcccaggcgt gcgcaattga cggtgaccac gccaacgctg    254400
     ccggtctgct cggcactgcc gaacaggccg ttgccgcgct tgagcagttc gcgcaggtcg    254460
     agttggagcc ggcagcacat ggagcgcacc atattcggct ccagctcgga gttgatgaag    254520
     ttctggaagt acggcagccc atatctggcc gtcatctcga acagccgctt ggcattctcc    254580
     gattcccacg gaaaatcgcg cgtgatgttg taggtcggga tggggaaggt gaacaccctg    254640
     cccttggcat cgcccgccgt cattacctcg atgtaggcgc gattgatcag gtccatctcc    254700
     ttctgcaact cgccataggc gaacggcatt tcctgcccgc cgatgaccgg cacctgttcg    254760
     cgcaggtcct caggacaggt ccagtcgaaa gtcaggttgg taaagggcgt ctgcgtaccc    254820
     caccgcgatg gcacgttcag gttgtagatc agttcctgga tgcactgccg cacctgtgca    254880
     taggacatgg cgtccttgcg cacgaatggc gccatataag tgtcgaacga cgagaacgcc    254940
     tgcgcaccgg cccattcgtt ctggagtgtg ccgagaaaat tgacgatctg ccccacggcg    255000
     gaggacatgc gcttcggcgg cccggcttcc accttgccgg gcacgccatt gaacccctcg    255060
     tgcagcagcg tgcggagcga ccagccggca cagtagccgc tgagcatatc gagatcgtgg    255120
     atatggatat cgccgttgcg atgggcctcg ccgatttccg gtgtgtagac atgggacagc    255180
     cagtagttgg cggtgacctt gcccgccacg ttcaggatca gtccgcccag cgaatagccc    255240
     tggttggcat tggcattcac gcgccagtcc gccttgctca ggtattcgtt gatcgaggct    255300
     tccacgtcga ccagggcctt gcggtcctgg cgcagcctgg cgtgctggcc gcgataggcg    255360
     ataaacgcgc gcgcggtgtt ccagtaattg gcggcaatca agacctgctc gaccacgtcc    255420
     tggatctgct cgacgcctgg tgtctggtta tggtaacggt gcgctaggac cctcgccacc    255480
     tgtccggcga ggctgactgc ctgcgcatcg ccgaactcgc cggccgcagc gccggcgcgg    255540
     cgtaaagccg actggatccg ctcaatggcg aatgccatgc tctcgccagt gcgcttgatc    255600
     acctccctag gtaggctggc aacagcggct tcggtacagt gctccataca ttctcccggc    255660
     aaaattcaca ctagatgcgg ggaaatcgta cgaccaaaac actatatgta gtttgacggc    255720
     gcgcaaatgt atgacatgtc ggctagtctt ggtcggcggt acgagagtcc gtgccgccga    255780
     aacggagttc agcgggcagc accgtcgcgg tagatcgccg ggtcagcttt gccggcgaca    255840
     tccagcactc cgaccaggcc cttgccggcg cgcgacagtg catggtccac cagcaggtag    255900
     ctgccggggt attgcacctt catttcgacg atggcgccgc tgggcagcac cagggtggtc    255960
     tgcacatcgt gcttgatgcc tgtgagcgag ccctcgctgt agaccttatc gaatacttca    256020
     ccgattacgt ggagcgatga gaccttgttg ggaccgccca cgccgaatta gatgcgcacg    256080
     ggcgcgccat gcggccgtgt ggtgtacatc tcgccctgca tcacgtagta gtcgcgatcg    256140
     accttcggca acccgccctc gggttcgacc aggatcatgc cgtacatgcc ggccgagata    256200
     tgctggggca ccagcggcgt cgcgcagtgg tgtgccgtcg tccagatggt cggccagctc    256260
     gaccgtttcc atgcggtact tcagcgtctg cggcgcgcgc gtgccgatgg gcgcgggcat    256320
     ggcggcggga tcgcctgcga tgctcccggc agccgggtcg cgcggggcga tgctgccgcc    256380
     gccgtgtaca aggcagtggc cgagcggccg gcctcgctct gtaccgaggc gggcgtcctg    256440
     gccgtgccac tgacctcgaa cacaccctcc atgccgatct gccggtgccc ggccacggtg    256500
     cagatgtagg cgaatttacc tggctgcgtc acggtaaagc gcagtgtcgc agggccggtg    256560
     ccggcgctga agcgcttcga tgtgacattc agttcgggaa tggcaagatc atgctcggca    256620
     ccctcgccgc tggcgatgga gatctccacc gtatcgccga cttccgcgcg cagcatgggg    256680
     ttgaccttgc ccgcctcgcc gacgaacacc atcttgccgt cgatgatatt cgtttgcagg    256740
     ttatggcacg gcggcggcaa tcgaaatgga aacggcagag gacaagtgga atgttctcat    256800
     gatgatgttg ttctcgttgt tgacttcaac cagggcgggt tgccgcggca gggccgccgc    256860
     aacccgctac ttgctgtgat gctgtaaatg cgcttaccgc tgcgcggcgt tcaggcgtcc    256920
     ttcgggcgcg gccagcgccg gtgccttgcc gagcaaccca agcaccacct gcaacgcgaa    256980
     cgacaccgcg ccgacgataa ataccacgtc gccgaaggta cgcacccagc gcagcgtctg    257040
     caggatcggc tgctgcatga attcctcact gcgcgcatac caggtgccat gctcgacgct    257100
     agccaggaac tggatgatgc cgaccggcag caagctagtc ccgatcatca gcaccagccc    257160
     ggcattgagc ccccagaacg ccgtcttcat cagccccgga ctgagccggt aagccggccg    257220
     cacatagcgc agcaccagca gcgtgaaacc cagcgccaga aagccataga ccccgaacag    257280
     tgccgcatgc gcatgcaccg gcgtggtgtt ctgcccctgg atgtagtaca gcgagatcgg    257340
     cggattgatc atgaagccaa acacgccagc gccaagcatg ttccagaacg ccaccgcgac    257400
     aaagcacatc agcggccact tcaggtctgc catccacggt gcacggtcct tcaggcgcca    257460
     gttgtcccag gcctcgtggc ctagcacgat cagcggcacc acttccagcg cgctgaatgc    257520
     cgcgccgacc gccatcaccg gcgtggtggt accggaaaag tacaggtgat ggaacgtccc    257580
     gggaatcccg cccagcatga agagcgaagc cgaggccagg cttgctgcag tcgccatcgg    257640
     gcgcgacacc agtccgagcg tggagaaaat gaaggccagc gccgtggtgg cgaacacttc    257700
     gaagaagccc tccacccaca ggtggaccac ccaccagcgc cagtactcca tcaccgtcag    257760
     gctggtgcgc tcgccgtaga agaggccggc gccgtagaac aggccgatcg ccaccaccga    257820
     cgaggtcagc agcgccagca ggttcttgtc gccgccgctg cgtgcgcgca gggcgggtgc    257880
     gatgccgcgc atcatcagca cgagccagat caggatgccg gcgaacttgc cgatctgcca    257940
     caaccggccc aggtcgacat actcatagcc ctgatggccc agccagaaat tcaggttggg    258000
     cggcagcttc tgcgcaatcg ccaggtagtt gccggtgaag gaacccacca ccacgaccac    258060
     cagtgcccag aacaggatgt ccacgccgag ccgctggtac ttcgggtcct tgccgccgtt    258120
     gatcagcggc gccaggaaca ggccggcggc aaggaagccc gtcgcgatcc agaacaacgc    258180
     gctctggatg tgccaggtgc gcaccagcga gtacgggaac cactgcgaga catcgatgcc    258240
     gtagaacttc tggccctcga ccgtgtagtg cgcggtgaag ccacccagga acacctggaa    258300
     cacgaacagc gcgaccacca ggaacaggta cttgccgagc gcgcgttgcg acggcgtcag    258360
     cgcgaagctc agcaacggat cgcgcgcggg cgcctgcggc agcgcttctt cgtgtccgcg    258420
     caggaaggcc catgcccaca ccaggaagcc cacgccggcc agcagcacga ccacgctgat    258480
     caccgaccac accacgtttt cgctggtcgg ctggttgccg atcagcggct catgcggcca    258540
     gttgttggtg taggttgcct cgtgccccgg gcgttcggtg gcggcggccc aggcggtcca    258600
     gaagaagaag tgcgtcagct gctgccggcg ttctgcgctc ggcagcgtgt tctccttcat    258660
     ggcgaagtgc tcgcggctcg tgtgcagctc gggcgcatcc gagaagagct tgtcgtagta    258720
     gccggcggtg gccgccattg cctgcgcgcg ccggttcgag acggtcagca cgcttgtggc    258780
     cggatccgcc gcgttgccgc ggtattcggc ccgcagctgc tcgcgcagcg cgcccctggc    258840
     cgcagcgtcc agcttgtcgt agggcttgtg gtaggcgtcc tgcgcggcaa gatcgagcca    258900
     cgccgtcagc tcgcgatgca gccagtcggc ggtccagtcc ggagcctggt aggcgccgtg    258960
     gccccagatg gagccgagct gcatgccgcc caccgactgc caggcggtct ggccgtcgag    259020
     gatgtcttcg ccggtgaaga gtgtccggcc gtccgccgcg accactttgg caggcatcgg    259080
     cggcgcctgg cggtagacct cggcgccgta ataggcgagc aaggaaaacg tgaccgccag    259140
     cacggcgatc agcaggaacc agagtctgcg atatgagccc atgatgagat tctcttgatc    259200
     gttgattggg tggaacggtg cccttggctc agtcgtttgc cccgtgcgtg gcgggcaggc    259260
     ccggctcgaa cagcacgttg ttttccaggt ggatgtgttc catcaggtct tcgcgcagcg    259320
     tgcgcagccc gaggtagagc gcccgccagg tattgcaagc cgcgcgaggc agcgtgatgt    259380
     cgttggtgag gtccgccagc cgctgcaatg ccgcgccgtg gtcgtcatgc tccatgcgca    259440
     tcacggtgat gggcgcaccg gctgcggcat ggaagccacg cgcgagcatt gggaacagga    259500
     cctgttcctc cttctgcatg tgcgcttcca gctcgctctg catttccgcc aggtgatcgg    259560
     ccagcccgag cgggcagtcg gggcggtcgc catggacatg ctccacgcgg cgcgcgagcc    259620
     ggatcagctc gggcagctgc tcgcgatggc ggtcatgaaa acgcgtctgg atatgggcaa    259680
     tcagcgcagc gggcgataca gtgttccagt cgttctccac cggctcggcg cccccttgca    259740
     acgccagcag gcgcgcctcg atggctgtgg catcgagccc tttctcctgc gccgcctcgc    259800
     gcagcgtgtg cttgccgccg cagcagaaat ccagcgaata gtcatgaaag atccgcgtgg    259860
     cgccgggaat gcggcgggcc aactggccga gggattggtc ttgcagggtc atgatgtttc    259920
     tccgtctgaa gttacgcatg catgacttac gcgaggaccg tgccaaataa aaaccgcgct    259980
     ggatcaatgg cttacaagac atacggtcat atttacctta aaattcgcat ggtatatttg    260040
     acccggaccg gtatttatca ccatgacgcc catgtatccc gagttgctga ccgacctggt    260100
     caccgacctg ccgcatgcgg tgcgcctgca gcggctggtc agcggactac gcacgcattt    260160
     ccgttgcggt gcggtggcgc tgctgcggct ggaagaagaa cacctgcggc cggtggcggt    260220
     cgacgggctg gtgcgcgata cgctcgggcg gcgctttgcg gtgagcctgc acccgcggct    260280
     tgccgccatc ctcgcgcggc gcgacgtcac ctgcttccat cacgacagca tgttgcccga    260340
     cccctacgac gggctgatcg acgaacacgt tggtgagccg ctgccggtgc acgactgcat    260400
     gggcacgagc ctgcatttgg acggaaggcc atggggcgtg ctgacgctcg acgcgctcac    260460
     ggtcggcacg ttcgacgccg ccgcgcaggc cgagctgcaa cggctgaccg tgatcgtcga    260520
     agccgccatc cgcaccaccc ggctggaggc cgagatccgc gccctgcagt tggcgcgtgg    260580
     caaacagcca gacggtgaag ggccggccga cgacggcgag atcatcggcc agagccaggc    260640
     cattgccggc ctgctgcacg agctggaggt ggtggccgac accgatctgc cggtgctgct    260700
     gctgggtgaa accggcgtcg gcaaggagct gtttgcgcac cgcctgcacc gccactcgcg    260760
     ccggcgcggg catccgctgg tgcacgtgaa ctgcgcggcg ctgcccgagt cgctcgccga    260820
     aagcgagctg ttcggccacg cccgcggcgc gttctccggc gcgaccggtg agcgtccggg    260880
     ccgcttcgaa gccgccgccg gcggcaccct gttcctcgat gaagtcggcg agctgccact    260940
     ttcaatccag gccaagctgc tgcgcacgct gcagaacggc gaaatccagc ggctgggctc    261000
     ggaccgtccg cgccgcgtca acgtgcgcgt gatcgccgcc accaatcgca acctgcgcga    261060
     gcacgtgcgc gacggctcgt tccgcgccga cctgttccac cgcctgtcgg tctatccgat    261120
     tccgatcccg ccgctgcgcg aacgcggcaa cgatgtactg ctgctggcgg gccgcttcct    261180
     cgaactcaac cgcgcacggc tcggcatgcg cagcctgcgc ctgtcggccg ccgcgcagga    261240
     cgcgctgcgc cgttaccgct ggccaggcaa cgtgcgcgaa ctcgagcacg tgatcagccg    261300
     cgccgcgctg cgttgcgtga gccgcggcgc ggaccggaat gacatcgtga cgctggaggc    261360
     ggaactgctg gacctggacg ggctggaatt accggcaggg tcagcccacc atgccgccga    261420
     ggcggccatc gcgcacccgg cgctacccac gggcgcgacg ctgcgtgagg cggtggagca    261480
     gacgcagcga gcctgcatcg agcaggcgct gcgcgcgcat gatggcagct gggcgaaggc    261540
     cgcgcggcag ttgggcatgg atgccagcaa tctgcacaag ctggcgaagc ggttgggcag    261600
     caagtagcag gcttgccgtc gggtcacatc ctgctgtcat gcagcgcgcc gccgctgaga    261660
     tctaccatct ctggcttcac ctcggcaaag cgcatcactt ggccgccgaa cgacgtggcg    261720
     aacttgcggg ccgcggcctc ctggcggaag ctggcgatcg tcggccccat cgagccccgc    261780
     cgcctgctgc cgagcacgta agtcccggtg cgggcatcga accagtatcc acgcggccgg    261840
     tcccagtcgg ccagctccat gtcctgcacg aatacgccca gcacggtgcg cacctgctcg    261900
     ggcttgagca gggtgctaaa catctcggcc gtgtcgcaat accaggtggg ccggctttcg    261960
     ccggcaaaat ggatctgggc cttggggccg ggatagtccg ccagcagcat gccgtccagg    262020
     tcgcaggtgc tggcgacgtt gaattccgcg ggaacaacgg tttgcccggt cttttgtccg    262080
     caggcggaca gcgctgcttg cgcgcccagc gcacaggtgg ccagcagcag ctggcgacga    262140
     ttgactctca ttggcggaac ctccaggtag caagtgccag cggcataacg atccaggcca    262200
     gcatcgcgcc gcccatcagc caggggcttg ccagcgcagg gggcacgatg gcggcgagcc    262260
     cgtaaaggct gcgcacctgg tcgagggaaa agacgttgag gatgcgaaag acatcggcgg    262320
     gattgagcag cagcgcgtac gccagcgctg cgccgccgaa ctcgccgccg ccggcgacca    262380
     gcagcccgag caacaacagg tcgaacacca gcacgtagcc gaaccacagc gcgatcgcca    262440
     gccccgaggc gcgcgtgcgc tcgcgccccg tcacggaaac cagcagggcc aggctcagga    262500
     acgccagccc cagcagcacc gagctgaaca tgaagcccag gtactggctc agtccggccc    262560
     agccgaactg gcgcagcagc agcaccgcca ccagcgcgaa gccggccagc gtggacaacg    262620
     ccagcgccgc ggccaggccg aggtatttgc ccagcagcag ctccagccgc gtcaggggca    262680
     tcgccagcag caggtccagc gagccgcgct cgcgctcgcc gacgatggca tcgaagccca    262740
     gcagcagcgc aatcagcggg atcaggtagg tcaccaggct caccaggctg gcgatcacgt    262800
     actccaccga ccgtgggccg agctggccct gctgggcgcc gccgaaatag gtgatgacca    262860
     gcgagaacac cgcgaacacc agcgccaccg ccagcaccca gcgattacgc atgcggtcgc    262920
     ggaactcctt ggcggccagc gtggcgatct gtccccattc tatgtcggcc atgcttatcc    262980
     ccccagtcca aagaacaggt cttccagcga aggctcgcgg atctgcaagt cctgcacgtc    263040
     gcccgccagc agcgacagca cggtcatctt ggccgtgcgc ggacagcgca gctcgatctc    263100
     ggcacccgtg gcttgccagc cgagcaccgg caccgcggcg aggcgttcgc gcagcgccgg    263160
     ctgcatgtcc ggctcgaccc gcaaggccag cgtcagcggc atgtcgttct gctcgcgcag    263220
     ctgcgccacg ctgcccagcg cccgcacccg cccgttggcc atgatggcca gccggtccac    263280
     gcgctcctgc agctcggcca ggatgtgcga ggtcatgacg atggtgacgc cctgctcccg    263340
     cagcgcacgc agcatggcgt agaaatcacg gatcgcggcg ggatcgaggc cgttgctggg    263400
     ttcgtccagg aacagcacgc gcggcgaacc cagcagggcc tgggcgaagc ccagccgctg    263460
     gcgcattccc ttggagtact cgcgaaccgg ccgcttgccg gccgcggcca gcccgacgcg    263520
     ctcgagcagc atctggcagt cccccgcgtc cgcgcgcttc agcctggcga agaagcgcag    263580
     cgtctccagc ccgctcaggt tgtcgtacag gaccaggttt tccggcaggt agccgatatg    263640
     ccggcgcgcg gcgcggaacg cgcggctgcg cacacaggcg ccgtccacgg tcagctcgcc    263700
     gccggtggcc ggcaccaggc ccagcatcat ccggaacagc gtgctcttgc cggcgccgtt    263760
     gtggccgatc aggccgaaca tctcgccgcg ccgcacctgc aggtcgacgc cgtcgaccgc    263820
     gcgcacggcg ccatagtgcc gggtaacgtc gcgcagttcg atcgcgcagc cgtcagcggc    263880
     cggggtaatg cttgtcacgc cagaagctcc agtctcgatg tcggggattc atgcgcgggg    263940
     ccgcgtcgac gacgctgggc acccgcagca cgggaaactg gcgcccgacc atgcgcagcg    264000
     cctgcaccgc cgggctgtcc agcagcagcg ccacacccgg atggcgccaa cgcagacggt    264060
     ccacgatgtc gttcgcctcg tagggcacgt caccgatgcc gtcgccgtcg cggtcccagc    264120
     ccaggtagtt gctccagtgg ttcccgccgg ggccgcctgc gcggtcgccc cacggctcat    264180
     cgcgtgcgcc gacatagcgc acctgctcgc ggttgccgat gaagtcattg ccctgcacca    264240
     cattgcgcgt cgaccccgcg gacagatgta cacccacgcg gttgtccgtc accaggttgc    264300
     tgcgcagcgt tgcgtactcg acgtcgtaga tgaagaagcc gcggtcgttg ccggcgacca    264360
     cgttgccttc aatcacggag tcctgcaccg tgcgcagcat gatgccgtgg tcagaattac    264420
     cccaggtgcg gttgttgcgc acgacctggt cgcgcacttc catcagggcc aggccgccgc    264480
     ggttgtagta gctgtcgttg tcctcccaca ggttgtggta ggagttcatg tagtggctgc    264540
     catagcgact gtggtggagc cggttgccgc ggaaggtcgc atggtgcgag acgtccacgt    264600
     agagcgcgtc gcgcacgaag ccgatgttgt tgccgatgat gcgggcgccg cgcgtgttgt    264660
     agagctggat gccattgccg cgctgcgagg aactgtagtc acgcttgccg gtgatcacat    264720
     tgccttcaat tcgcacgtcg tcggccttct cgatccacag cccgaacagg ttgtaggtca    264780
     ggtcgcagtg gcgcacgacc gcgcggtgcg cacccggccg gatgtagagg ccggcgttct    264840
     ggtccttcag gctgtcgccg gaatcccgca cgatcaggcc ctccaccagc acatccggcg    264900
     cggtgatgcg cagcgtgtcg ccgtgcatcc cgccactgag tgtcggcctg ccgatgccgc    264960
     gcagcgtgag cggcttgtcg acgacgaaat tgccgtcgta gcggccgcgc tcgatctcca    265020
     gcacgtcgcc ggcgtgtgcc atggcgatgg cctgctgcaa cgcgtcgccc ggcttcacgc    265080
     gccgggtttc cgccagcaca ttgcgcacca gcagcgccat caacagtgag gccagcagca    265140
     acgcgcccaa cgacggcatc cggcatcgtg cgtgtctcat ggcagcagca gccccatggc    265200
     cttcagcgtc aggaacagcg ccgcgccgat cagcaggttc ttgaagccga cgtagctgac    265260
     catgtccatc cagcccgcgc gccggtagcg gttgcgccac cacgggccgt cctggacgta    265320
     gcggcggccc gccatgcgga tcaggacctc gtacgtgctc cacccgaacc accaggcgat    265380
     cacggccacg gacgacagct gcccgagtgc ggccagcccc caggccgccg tggcggccag    265440
     cgccaccgac atgccggcca gcagcagcgc acgctgcgag cgccagcccg ccatgctcca    265500
     cggccagagg tgatcgcaca gctccagcca aagccgcttc aggccgacgg ccttggccat    265560
     gtgcaacggc gcgaccggat cggtcggcat gcgcggatcc ggtccgttgg cgactttggc    265620
     tggcattggc gccaccggtt ggatcgggat gaaatagccg tcgcggccaa tcggcgtaag    265680
     cgcgagccca tcgcgctcgc gccgcttgcg ttccctggcc agcggcgggc agccgccggc    265740
     gtcggtatag agcaccatgc aatccaggca gtgcaggcat tcgcgatggt cgatgcgacc    265800
     gttcgcgtcg attgcctgcg agccgcagcc gacggcgcag gccttgcagc tgttgcagtc    265860
     ctgcttgcgc cgcagcccaa accagcggaa ggtgctgggc atcgccagcg cagcaccgag    265920
     cgggcagatg tatttgcagt agggccgctc gacgaatagc gacaggccca gcagcgtgca    265980
     cacgaacagg ccgtacggcc aggcgcggtg cgtgatgccg accaggaacg tggtcttgaa    266040
     aggctcgacc tcggcgagct tctcggccag ccccatcgag aacatcgaca ccgccagcag    266100
     cccgaagaag atgacgtact tcaaccattt caggcggtcg tgccaggccc gcggcagatg    266160
     ccgctgccag cgccgcagac cgatcatgcc gccgaacttg tggatggctt cggacaatga    266220
     cccgaacggg cacagccagc cgcagaacag cccgcgcccg aacacgaata ccgtcaggat    266280
     gatgaagatc cagaacagga agatgaacgg atcggacagg aacagcgacc acgtccactg    266340
     gaacagcagc gcgtggaacc acgtcagcac ctgcgtgacc gacggctgtg ccatcgcgcc    266400
     gaagcccacg aagccgatgc tcagtgccca ggcgctgtac ttgaaggcgt tgacgggcca    266460
     cttgttccga agcgtcgccc ggcgcgtcag ccgctcgcgg aatgcataaa cgacggtcac    266520
     gaccaccagc agcgcggcga acagggcaat cccggccgcg cgcgacttcc acacccgcac    266580
     ccagggcgcg gcggggtcgt cgatctccgg ccggccaccc tccagcaact cgcccggcaa    266640
     ccagtaggcc gcatcgaagc tggtaaagct gcgcgccccc gtggcgcggt cgacgcggtt    266700
     gccgagcagc gacagcttcc acggatacgc cgacgagaat gctttcgagc ggatcacgaa    266760
     gatggccgat tcgttgtacg ccggcgcgcc ctcggcggcc aggccgtaca ggttcaggta    266820
     gtcgaggtcg cggaaggtaa aggagtcggc cccctgcttc acctgcacac gatcatagat    266880
     cccgccgcgc acgaagcccg agcccttgaa cgactccgag ccggcggtgc ggatgatgaa    266940
     gatcgcatgc tcgtccggct tgagctgcgt gcgcaggttg gcgtagccct gctcgccgag    267000
     caggctgcgg cccacgtcgg gatggtccag gttgccgaac cagagctcga tgaagggatc    267060
     gtccgaacgt gccagcccca cctgctcggg catgacgcgc agccgctgga ccgccccttg    267120
     cgccgccagc tgagtccagc tcgcgtgcgg gttgcccggc gcgaagcggg ccggctcgcg    267180
     ccgcgtgggc gcgaggatgc cgacctggcg ggccactgcg gcgccggcgg tcgtcaatac    267240
     ctggttctgt gccatcacgg tgaccgtggc gccagagatg gcatcgacgc ccagcacgcc    267300
     ctcgtcgggc ctggacgccc cgatctcgat cttgtcggcg acggacttgc ccaggtactg    267360
     ctggttgaac ttcaacagtg cagattccgg aatgccgagc agcaggatcg gctccgaatg    267420
     cttgagcact tttacgccga cgaatcgccc attcgtgtcc atgccgatca gcgtcaccac    267480
     cggcttgccg gaataggcgg gcgtgtcggt aatgtcggtg gacagcatca cgtagccaag    267540
     ctttggcttc ttgccgtcgg caccggcgcg gccgtaggcc tcgacgtagg gaggctgccc    267600
     gatgcgctcg gaaaagctct ctgcgcctgg aaagacttcc tggcatggca ccagtgcgca    267660
     aaggttgcgg gcggtgcgca ggtccggcgg caatgccgcc tcgtaggcac tgcccgcatg    267720
     gaccgggcgc gggccggcca tgagcagcag gaaaagggcg gccacgatgg ccgcaccaaa    267780
     atgcttcagg ggctgcatgt cgttctcgtc tgtcccgcgc ggccacgagg ggaaaccatg    267840
     gccgcgcggc tgctcgggct caggcctcca caatcatgcg ggtgcgcatt tccaggtgga    267900
     gtgcgtggca gaagtgggtg cagtagcacc agaacacgcc cggcttgtcg gcaacgaagg    267960
     tgaccgatgc cgtctcctgc gggttgacga tgaagttgac gttgtacttc gggatcgcga    268020
     agccgtgggt caggtcctcg atcttgtcga gattggtcag gatcagcgtg acctcgtcac    268080
     ccttcttcag cttgaactcg cgcaggctga aggccggcgc ctgcgacgtg atcttcacgg    268140
     tgaccttgcg gccattgcgg aacacgcccg actccttcgg gtccttgatc gccagcggga    268200
     agtcgtccag cgcgtagacc tgcttcggcc gcaccagctc gcgtttaaag atgatgaagt    268260
     catgcggctc gccacgcacc gggtggtccg ccatcagcac catcttctgg ccggagatgt    268320
     cgatcagctg ctcgttctcc ggatgcagcg gtccgaccgg caggaaacgg tccttcgaga    268380
     acttgcagcc gaccgccagg tacttgccgt cggccgcaac cgtctcggac tgcgaggcgt    268440
     tgacgtggcc gggctggtac tgcaggtcca gccgatcgac cacgtacttg gcgttcttgt    268500
     cacccttgtg gaacttgatc gccgcatcga gattccattt cacgagctgg ctgtcgagga    268560
     acagcgtggt gtaggcattg ccgcggccat cgaaggccgt gtgcagcggc ccgagaccca    268620
     gctccacctc ggcgacgatg gcatcgtcga gcttctcctg cttgccgtcg aaccagccaa    268680
     gcacgcgcga cagctcgatc accgtggccg tgggcgagag cttgcccgcg cagatgaagt    268740
     acttctggtc gggactggcg ttgaccccgt gcgggttctt cggcaccgat acgtaggccg    268800
     tcagcgcggt cttcgggtcc ttgttggccg cttgcgtgcc gtcgaccacc ggcaccttcg    268860
     aatcgccgta ggtcttgaac ttgcccgcct gcaccgccgc ctcgatacga gcgatgttga    268920
     agaatacgca ggcatcgcgc tcggcggaca tcatgtcctc gaagtgcgcg ccgttttccg    268980
     tgttgtactg gttggtcgcc gccagcttgc cgtcatagga ggtggccacc aggtcgcagt    269040
     tgccgtcgat cagcacctgc cagcgcaccg ccatcgtctc ggcgtccacg caggtgaaca    269100
     ggctgcggta cttgccggca tcctcggtcg gcgcactggg cagcggaatg ccaaactcgc    269160
     cgccgcagaa cacgcgtgtg gtgtagttga tcttcgtgtc gaccggatcc cgcttgtccg    269220
     ggaagatgcc gtggaagccc tgcacattgg gcaactcggt gatcttgtcg cagatgaagt    269280
     agtcgaggcg gatgcgcgcg atgcgggaat tgatcttgtc gttgacccag gcatagcggc    269340
     cgtcgtagtt gccgtccttg tacgaagcat gggtatggtg ggtatcggcc accgtgtagc    269400
     gcagcgtgcc gtccggccgg gcgcccatca ccttcttcga ttcattggta atgccccagc    269460
     cgaccagcgc atcgggcacg aagcacggga tgcgcaggat ctcgcgcccc gacggcagcc    269520
     ccagcacgcg catgtcgccg gtatgcccgc cgctccagag gccatagtac gtatccagtt    269580
     ccccgggctt gaggtgcacg gacgcgcctg cgccgtgcgc ggccccgtgt gccccgcttg    269640
     ccggtgcgcc aacggccgcc gccgcgggcg cggcgccctt gtctgtgcag gcgaccaccc    269700
     ccgctaggcc ggccagcgct gccgtgccga gaaactggcg gcgaccgata ccgcctggac    269760
     cgttgccgat cgatgccttc tctttgctca tggagaaccc tcgaagagat atgtgccgga    269820
     atcaccggct gttttgcaga tgtttgtgaa caggcgaatc ttcgaagttc cggaccagtc    269880
     tgaacttgac tcgaatcaaa aggcaacaaa acaagtagaa aaatgcatga ataaggccgg    269940
     caccgtgcaa ccactgcacg cctctgcttc ttagaatgga tgccacacaa acggagcatc    270000
     tgatgagcaa gaggaagatc gtggtattgg gcatgggcat catcgttcag gcactggtcg    270060
     cctgcggcaa gcagacaccg gccgagcccg cggcggcggc ccccgcacca gagccggcag    270120
     cagcagtggc cgccgccgcg cccgtgaacg agctgggcaa gtcggtgtat ggcaagacct    270180
     gcgcgatgtg ccatgcggcc ggcgtggccg gcgcacccaa gccgggcaac aaggacgact    270240
     ggggcccgcg catcgcgcag ggcaacgaca cgctctacaa gcacgcgctc gaaggcttca    270300
     ccggcagcaa gggcatgatg ccggcgcgcg gcggcagtac ctcgctgcag gacggcgacg    270360
     tcaaggccgc cgtcgacttc atggtggcgc aatcgcactg acgcatcgac atgaacgctt    270420
     cccgtcctga caggccgaac ccgggacggc ggcggctgct gtgcgcatgg ccgctgcttg    270480
     ccacgggctt atggatccgg cccgcactgg ccgacccgcg cgtagcacag tcgtcgcgca    270540
     cgctgatggg tacccgcgtc gacatcaccg tgcaagcccg ccatgccgac accgcggcgc    270600
     cggcgatggc ggcggcctgg gccgagatgg cgcggctcgc cgacctgatg agtcgctacc    270660
     gcgtcggcag ccaggtccac gcgctgcaac tggcggcggg cgtgcagccc gtgaaggtcg    270720
     cgccggagat gctgcgcgta ctcggcatgg caaaccggat gtcccggcgc agtgccggcg    270780
     cgttcgacat caccgtcggc gccttcgccg gctggaactt cgatccggcc cacccggcaa    270840
     tgccggacca ggccgagatc gcacgcgaac tgccgctggt gaactatcgc gacgtggtgg    270900
     tcgatccccg cgctgagact gccttcctgc gccggcaggg catgcggatc gatctgggcg    270960
     gcattgccaa gctgccggtc ctgcaggccg gcatggatgt cctgcggcaa cacggccttg    271020
     acggtgcgat gatcaacggt ggcggcgacg tgctggtcag cggcgcgctg caggggcgtg    271080
     catggcgcat cggcgtgcgc gacccgctcg cgccagcgcg actgaccggc gtgatcgcca    271140
     tgcacgacgg cctggtcgcc gcatcaggcg actacgaacg ctgcttcatg caagccgggc    271200
     gcaggtacca ccatatcctc gaccccggca ccggcatgcc gagcgcgggg ccgcacggcg    271260
     tgacactggt ggcgcgcggc gtggacgaca tcaacgggct cggcgctgcc atcatggtgg    271320
     caggcgagac cgcgggccgg cactggctgg aggcattgcc cggcgtcgac gccatgatcg    271380
     tcgggcccgg cgggcggcgc tggctgtcgg ccggcatggc gggtcgcctg atcggctgac    271440
     tgcacgcctg gcaatggcgg ccgcacaggc gtgcggcctt ccctcacagg ctgtttgaga    271500
     atcccgcggt ccccgcatca gccgggcact gcccggccaa gcattcgcga caccacgtcg    271560
     ccaacccacg ccggccgcgg cgcggcatcg agccagtatt tcacttccag cccgagcgcg    271620
     gtgtcgccgc tgatcaccag cttgcgctgg aagaacagcg tatcggtatc ggcttcgccg    271680
     cccagcaggc gaagatagtc gaccgcgcgt gcgcgcagcg tcagcgcggg ggcggaacca    271740
     tccgagcggc cggtatggaa gcgcccgccc tcgcagcgaa atggcacgtc cagccccaga    271800
     tcttccaccg tcagcaggaa gctgtgccca tcgagcgccg ccggcggttc gagccaaccg    271860
     gcacggcgcg cgatttccag cgcggcaacc agcggcagcg cgcaggcacg tgccggcatg    271920
     cggcgatgca cgcccgccat cagcgtttgc agtacactca cgtccgctcc tcccacacga    271980
     taccggccgc gccgtgccag tagccattgc agggctgcgc gccggcgggc gtgatgccgg    272040
     tcggggcggc ggggcgttcg ccggcgcgta tggccgcgag cgtggccacc acatccagcg    272100
     ttcccgacgc atgcggactg acacgcagca tatcgacgcc catcgccgcc atcgacaccg    272160
     cttccccgca caggtcgagg caggtggcgg actgcgtctg cacgccgttg agggtgaaga    272220
     acggctgccc ctcaccggtg gcggcaacca gcccgtccgg atagtcgagg cagcggaact    272280
     cgcaactgtc cttgcgcagg cggtgatggc gcgcggtgaa gcagcgcgcc gagaacgcga    272340
     gcggcatgcg gccccagacc atggcttcga gcgagacgcc acgggggcgc cccgccgcca    272400
     gtctgcagag cgtaggccca tccatctcca ccggcaccgc acagcccctg gcgcccagac    272460
     ccgcaagcca cgccagcgta tcggcgtggt agacgttcag gtgcgggccg cccacgaatg    272520
     gcctcccgcc catgcagcgc accgcgccga ggtcgttggc ctcgaccagg tagtcatcct    272580
     gctcgcagac gcgccgcatc caggcgatat cggtgtcgga ctcgatcagc accggggtgg    272640
     acagcaccac ttccttgccg gcctcgcgca gcatcgtggc aatttccagc cagtgcgcat    272700
     ggcgcaactc gtgccggcgc gtgcagacgg tctcgccgag atagacgcga tcaactgccg    272760
     aatccgccgc cgccgcgtag aactgcatca cggtttcgcg cggccagtag taaagcagcg    272820
     gcccaagcgc aatgccgaag cgcggcacgt tggcggcctg ctgcgccggg acgaaggttt    272880
     cagacattgg tgcacccatg ggtagtcgcg ctcctgttcg ggaaattgtc ggttggcgca    272940
     gtcagcgcca cgggcggtcg taggcgcctt gcgtgacctg gtcgccttcg gcgtggcggc    273000
     ccagcgtgct ctgccattcc tggcgcggcg caaagcgagc cggatcggcg cacgcagcgt    273060
     cgatggcggc acgcagcacg cccacgacat cgcccacata gcgggggctg cgctggcggc    273120
     cttcgatctt gatggcggcg atgcccatgt cgatcagcga cggcagcagc gacagcgcat    273180
     tgagactggt cggctcctcc agcacatagc cgcgttcgcc ttccacttcg aagcgcccct    273240
     tgcacagcgt ggggtagccg gccggctcgc cgggcgcgta gctgtcgatc aggatgcccg    273300
     acagcctggc gtgcagggtg ccgtcctgct cggtccagcg caccgcgtgc gcgggcgagc    273360
     aaacgccctt gttgttgggc gaatcgccgg tggcgtagga cgacagcagg caacgcccct    273420
     cggccatcac gcacaggctg ccaaagccga agacctccag ctccacgctg gtctggcgcg    273480
     ccagcttgcc gatctgcgcc agcgacagca cgcgcggcag caccacgcgg cggatattga    273540
     agcgttcgcg catcagttcg atggcatcgg catgggtggc cgagccctgc acggacaaat    273600
     gcaggcgcag gtcggggtgg cgctggctgg cgtagcccat cagcccggca tcggccatga    273660
     tcactgcatc ggcacccagg tccgcggcgg cgtccaccgc ccggtgccat tgcccgaccg    273720
     cgcccatctg cgcaaaggtg ttgatggcga acagcacctc ggcgccgcgc gcatgggctt    273780
     cggccacgcc ggtgcggatg tcggcctcgg tgaaattcag tccgccgaag ttgcgcgcat    273840
     tggtggcgtc gcgcagcccc aggtagacgg cgtcggcgcc gtgctgcagc gccatgcgca    273900
     aggcggccag cgagccagcc ggcgctacca gttgcgggcg gcgcggcggt tgcggctcgg    273960
     ccggcgattc gggagaagag aacttcatgt cgggaatggc cgctgccggc gcgaggatct    274020
     gaccagccga gatgttagcg aggcaccacg cccgtgagct tgatcgtgcg caaattgcga    274080
     ctgaccacgt cagcgatgcc cgccgcctac gccgatcggc gtacgccgtt ggcaggcagc    274140
     tggcccggca ttgacctgcg gcaaacaccg gccgctgccg ctgtgccacg cttggccaac    274200
     tatccgcacg cggcggcatc acttgagcga gatcgacatg aaagaacatt ggctgaagct    274260
     agccgggcgc cggctggtgc cggtcgtaca gggcggcatg ggcatcggca tctccgcgca    274320
     ccggctcgcc ggcacggtcg ccggcctgaa cggcatgggc accatcgcca gcatcgacct    274380
     gcgccatcat catccggacc tgctcgcgca gacgcgcggc acgcgcgaca agccgcgcat    274440
     cgaagcggcc aacctagttg ccctggaccg cgagatcaag gccgcgcgcg cgctgtcggg    274500
     cggccgcggc atgatcgcgg tcaacgtgat gaaggcagtc ggctcgcatg cggcactggt    274560
     gcggcagtcc tgcgaaagcg gtgcggatgc gatcgtgatg ggcgcggggc tgccgctcga    274620
     cctgcccgaa ctcaccgcga actatcctaa ggttgccctg attcccatcc tgtctgaatc    274680
     gcgcggcatc gggctggtgc tgcgcaaatg gatgaagaag ggccggctgc ctgacgccat    274740
     cgtgatcgag catcccaacc acgcgggcgg ccacctgggc gcgccggcca tccaggaact    274800
     cggcgaagcg cgcttctctt tctcgcgcgt gctcgccgaa tgccgcgagc tgttcgcctc    274860
     actgggcctg gcttgggaaa gcattccgct gatcctggcc ggcggcatcg acagccacgc    274920
     caaggtccgc cactggatcg gccagggcgc cgccgccgtg cagctgggca cggcgttcgc    274980
     ggtgaccgag gaatgcgatg cgcaccccgc gttcaagcag gtgctggcca ccgcacgccc    275040
     ggaatcgttg cgcgagttca ccagcgtggc cggcctgccg gcgcgcgcag tgctcacgcc    275100
     ctggctcagc cgttacctgt cgagcgaagc caaattgcag cgccgtgcca aggtacgcga    275160
     gtgcctggaa ggcttcgact gcctgcagtc gtgcggcctg cgcgacggca tcgcccgcat    275220
     tggccagttc tgcatcgacc tcaagctgtc gcaagcggtg cgcggcgacg tggagcgcgg    275280
     cctgttcttc cgcggcaagg gcgcgctgcc gttcggcgag gcgatccggc ccgtggcgga    275340
     actgatgcat tacctgctca ccggcgagaa gcctgccgcg ctggcggcaa cgtcggcgcc    275400
     ggccatggcg gcctgaggct agcgggccac cgatgcattc caccccctga ctcgccatcc    275460
     ttatgcttat ttcagcggca agcgcatcct gatcaccggg ttgatctcga accagatgat    275520
     cgcctttgtc cttcggcgat cgcgtcttga aggcgtcgcc ctattcctat catcaagtcc    275580
     aaagggatct caatgtccaa gtctgacacc acatccttac ccctcgtcta cgcctgctcc    275640
     ggctgctcca gcgtagcgca actcgccaac accgtcgcag tacggctgga tcgcggcggg    275700
     ttggccgaga tgtcgtgcat cagcggggta ggcggcggcg ttcccgcgct caccagggtg    275760
     gcccgctcgg gccgcccgat cctggcgctg gacggctgcc cgctcgcctg cgtgaaagcc    275820
     tgcctggcca gcgcgggtgt tgcgcccgct cagcatctgg tgctcaaccg cctaggcgcc    275880
     actaagcgac agcatggcga atgcagtgaa gcggaggctg gcgctgtctg ggcggcggta    275940
     actctggcac tgtccgccat caaagatgcg ccgccgcagc ttgctgacaa atcggcggca    276000
     ttggtcaaag ccaacgggac actccggcac cgattgcagt gacgacggcg cttactccct    276060
     tccccccctc ttggacgtca cggggagagg ggtgggttgg ctaggccgtt cggggaaagg    276120
     atccggcccg tggcggaact gatgcaccac ctgctcaccg gcgagacgcc ggcagcgctg    276180
     acagtcgcac ccgcaggcag cagcggcctg aggcagccat gatatcgatc cattccaccc    276240
     actcaccaca catccctatg ggcattctca gtgggaagcg catcctgatc accgggatgc    276300
     tttccaaccg gtcgatcgcg tttggcatcg ccaccgcatg ccggcgccaa ggcgccgaac    276360
     tggccttcac ctatgccgac gaacgtgtcg cggcgcgcgt gcgcgaactg gcggcggact    276420
     tcagcagcga actggtcttt ccctgcgacg ttgccagcga tacgcagatc gacgcggccc    276480
     tggcttcgct gcgcgcccac tggtcgcagc tcgatggcct ggtccatgcg atcggctacg    276540
     cgccgcgcga ggcgttgtcg ggcggcttcc tcgacgggct gtcgcgcgac agcttccgca    276600
     tcgcgcacga tatttccgcc tacagcttcc ccgcactcgc cagcgccgcg ctgccgatgc    276660
     tggcaccacg cgccgtcttg ctgacactgt cttacctggg cgcgcagcgt acgctgccgc    276720
     actacaacgt gatggggctg gccaaggcct ccctcgaagc cagcgtacgg taccttgccg    276780
     ccgcactggg cgggcgcggc gtgcgtgtga acgccatctc ggcgggccca ctgcgcacgc    276840
     tggctgccgc cggcatccgc gatttcggca agatcctgga acacgtggca aacactgcgg    276900
     cattgcggcg caatatcgac agtgaagaag ttggcaacgt ggcggcgttc ctgctatcgg    276960
     atcttgccag cggcatgacg gggcaggtca gctatgttga cgccggatac cggtgcatgg    277020
     cagccccgct cgacctggca gattagtccc cacgcagcgc gaccacgtcc agtggcgcgc    277080
     tgcaatcacc tctcgtttga ggcggcaacc tgtcgcgcca gtccttccgc atcgagcagg    277140
     aagatcttcc ctcgctccag cttcaccagc ttttgcgccg agaaccggct catcacgcgc    277200
     gacagcgtct ccggcgtgac acccagcttc gatgcgatca cacgctgcgt gcaggccagc    277260
     cacgtgcgcc ggcccgcctg cgcctgctca tgcaggaaac ttgccacacg ctgcaaggca    277320
     ttctgcaggc tgacggcctc gatatcgcgc atcagcgtat gcagccgtcc ggacaggttg    277380
     cgcagcagct gggtggacac tagcggatcg cgctcgaccg cgccccatag cgcaagcttg    277440
     ctaacatgca gcaccgtcgt gcgcgcctgc gcctggcaat ccgcgacctg cggcgcatcg    277500
     aggaataagg cgtcctcgcc gaagatggcg cccggcccga acacctcgat ggcgcgctcc    277560
     agcgtgcgct cgctggccgg cgccgtcggc agggccagct tcaccaggcc ctcgacgacg    277620
     acatacaggc cctggcaggc ctcgccgcgg cgaaacagga actccccttt gcgcaggtgc    277680
     tgcggcgtag cggcctggcg cagggcatcc aggacttcgg catcgatgcc gcgaaacaac    277740
     ggcatccgcg cgaatgggat cgggtcagcc atcacggcct ccttcgacag gcaatgttgc    277800
     ggggcgcggc acacgtggcg gcagcccgcc ctgtgcacgc atccggcgca tgcaacgcag    277860
     cgccgtcagc agttgcacgc ccagccagag attggcggcg gcaaaagcca gcccgccggc    277920
     gggtgccagc cacgccggcg cgaccggcag tgccagcagc atgagatagg cagccagcag    277980
     cagcatcgcc tgccgccgct gcctgccggg ggcgataatc gcctgcatgg caggcacccg    278040
     ggcgcgaggc ggcagcagct tgcgcaggtg tagccagacc aggaacggca cgatcttgcc    278100
     gagcatggcc gtcaccggca gcacgccgcc gccgatcagc gcgagcgagc cgatccacca    278160
     ggccagcggt gcccgactat ccggcacgaa gggcatggct gcggcaagca aggcagcggc    278220
     cagcatgctt gcgcacgcca cgggccacaa cggccagacc ggatcgtgcc tgcgcttggc    278280
     cttcagcgtg ccggcgagtc cgaagccggc cacgaccgcg gcgaccacca gccagggcag    278340
     cagtgtccat tgggagagtg ccgtcgagcg cggccaagcc accactgcca cggtgaatgc    278400
     gagcagcggc acccagtgcg cgagcggcag ccatcgctcc agtctggctg gcagccgcga    278460
     cgtttgccag aacatcggca ggaccgtagt cgccacgccc gtcaccagcg ccgcgagcca    278520
     gccgccaaga ccccacgcta tgtgcagtgc aagcagcggc gcgggcgatg ccggccacaa    278580
     gccgccgaac aaccctgcca gcacgccacc gcacaaagcg gtcaacagca gcggcgcgcc    278640
     gatccacgcc agcgtgcgtg tcgtggcgtc gaccgccgcc acgcgcctgc ctgcgccgag    278700
     aaggagcaag cccgccagca ccaggaaggg cgcacccagc aacgcggccc agcggaaagc    278760
     ggccgcgctg ccgccaagga atcccgccga caacgccagc gcgctgccgc cgccagacag    278820
     cgcgaccagc ggcgccatcc agccggcacc gggcaccgtc acgccggcca ccaccggcat    278880
     catctggaac agcgcaccaa gcatgaccgg cagcagcatg ccgagcgcca gcacgtgcac    278940
     cgccgccagc gcgagcggtg cgaagcggtc cggcaagccg tccaccgacc cgaatgccag    279000
     cagcaggccc gccgccgcgc ccagccatgg cgccggcatc aggcagccga acaccacgcc    279060
     gggcggcggc gcacgctcgt agtccaggtt ggccgctttc acgtcggtga tccctttgct    279120
     ggcctgttgc gatcacggca tgcggtcagg cgatgccggc cagcaccgcg tccagatccg    279180
     gtacctgtgc gcggcacatg ggaaagagca cgttctcttc cttcacgttg tgctgctgca    279240
     gcaataccac cagcgtgtcg atctcggcgg ccagcgcatt accgtcgcgc agttccagcc    279300
     attcgcgcgc attgtccagc aggaccctca cctcttcatg ttcgtggcgc atgaccgagg    279360
     tcgggccacc ggcaaagccg atggcccgct cgaacgcggg aaacagccgg gattcctccg    279420
     cctcgaagtt gcccgacagc tccgcctcca gccgcgcaag ggcgcctgca atgagatccc    279480
     agtcgccgcc gcgcagggcg gtctccagct gcccgagcgc gtcatcgcac ccgcgatgct    279540
     gctgcaccag tgtttcgatt ccagtggaca tagtgattct ccggttcggt tcgaatgcat    279600
     gctaggtcgc ggcctgcgcc ctggctttga tcctgaataa gttcccccgg gaaaagacgg    279660
     aaagacccgg cactcagtag ggaaactgga agcgcccggc acaaaggctt tggccgacca    279720
     tatgtcacat cgtgacctat tttttcggca cggctgccgc tggcgcccga gacgcatcga    279780
     aatgaggttt tcagcgcact ttcccgtgcg cgccgattgg ccgttcttga tctggctcat    279840
     gtatcgcccc ccgccatgcg cccacaattc agacactggc ttcgcgcgcg aagccagtgc    279900
     ttcatcgtct tcattgccac cccgatcctc gcctcatgtc caagaccacg ccagatccta    279960
     cttccgacga ggtgcacgaa agcatgcccg actccggcgc cgatctcgcc acgctgcccg    280020
     cattgcggca ccggctttcg acacgcatca tttcgctgtc gcttgcatcg ctgttggtcg    280080
     tcctggccat gatcgccggc acgctgtggc tgtcgtggaa gctcgaaggc gccggcgcgg    280140
     cgatcaacga tgccggcagc ctgcgcatgc gcgccaaccg cgttgccatc gagctcacac    280200
     tatcgcaggc cggcaagccc aatgcgctgg acgaccagat cgccgcgctc gacaacacgc    280260
     tcgcccagct gcgcaagggc aaccccgccc ggccactgtt tctgccggac gagccggcca    280320
     ttcacgcaca gctcgaccgc gtggtggacg gctggcagca ccggctcaag cccttggcgc    280380
     gggccggcgg gctaatggcc ggccaggcca cgactgccta catcgacgcc ctgcccagct    280440
     tcgtcacgca ggccgaccgc ttggtcggca tgatcgagca cgtcagcgcc agcaagaccg    280500
     atttgctgcg cgtgtcgcag gccggcctgg cggccatggc ctgcgtgggc acggtggcag    280560
     tgatctacct gctttacctg tggatcatcc tgccggtgct gcggctgcag gacggtctga    280620
     ggcgcatggc ggcgcgcgag ttctcgctgc gcctgcccgt ggagacccgc gacgagttcg    280680
     gcactctgaa tgaaggcttc aaccgcatgg ccagcgagct gcaggatctc taccgggacc    280740
     tggaagcacg cgtggcgcag aagaccgccg aactggcgca ccagaaccgc gacctggaaa    280800
     cgctgtacga gatggccgcg ttcctcaatc aggcgaccga tgccgaagcc atgtgcaacg    280860
     gtttcctgca gcgcgtaatg cggcagttcg atgcggacgg cggcagcgtg cgtgcctttg    280920
     acgatgtccg cggcaagttg ccgctgatga cgtcgatcgg cttgccagcg gcactgtccg    280980
     gtgccgcgca atgcgtgtcg gtcaaggcgt gccactgcgg cgacgcgacc acgcagtccg    281040
     tgatcgccat ccaggacctg cgccatgcgc cggcccgcgc cgccggcccg gtcagcccct    281100
     cgccctgcac gcgcaatggc ttccaggcgc tggccgcatt ccgcatcggg agcctgcgcg    281160
     gcgcaaccgg cgtcttcgcc ctgcatttcc gcgagccgcg cgagctgccg ccttcggacc    281220
     gccagttgct ggaaaccctc ggccggcacc tcggcaccgc gctggaacag ctacgtctgt    281280
     ccgactccgc ccgccagctg gccgtggtgg aggagcgcaa cctggtcgca caggggctgc    281340
     acgacagcat cgcgcaaggt ctgaacttcc tcaacctgca ggtgcagttg cttgccgatg    281400
     ctgtgggccg cgacgacctt cccgaagcgc gcgagatcgt gccgatgctg cgccacggcg    281460
     tggaagagag ctaccaggac gtgcgcgagc tgctgaacaa cttccgctcg cggctgacgc    281520
     cgggcgagtt gcgtccggcc gtggaagcga ccgtggaacg cttccgccgc caatgccgca    281580
     ccgaggccac gctgatcgtt gacgatggcg gcgacgtcct gccactgcat ccggagcagc    281640
     agctgcaggt gctgttcatc ctgcaggagg cgctttccaa tgtacgcaaa cacgcgctgg    281700
     cggctcacgt caccgtgcgg ctcagccacg gccgcgattt ccggctggtg gtacacgacg    281760
     acggcgaagg cttcgaccct gccgacctcg cgcaacgcag cgacgcccac atcggcctga    281820
     acatcatgcg cgaacgcgcc gcgcgcctga acgcccggct gcagatcgac agccagccgg    281880
     gggcaggcgt gcgcatcgca ctgctgttgc cgcgcggcga acaacaaccc gacgccatgg    281940
     ctgccagcca actccaaaat accttcccat gaccatctgc atcctgctga tcgatgacca    282000
     cacgctgttt cgctccggca tccgggccct gctgcagcgg caggccgatt tcgaaatcgt    282060
     cgacgaggcc gccgacggcg tggaggacat caagcgcgcc aagcagcgcc ggcccgatgt    282120
     catcctgctg gacctgaaca tgcccggcct gtccgggctg gaagcgctcc agctgctggt    282180
     ggaagatctt cccgatagcg cagtgatcgt gctgaccgtg tccgaagagg ccgaggagct    282240
     tgccatcgca ctgcgcagcg gcgcgcgcgg ctacctgctt aagaacatcg agaccgaggc    282300
     cctgaccagc gccatccgcc gtgctgcggc cggtgaaccc gtgatctccg aaagcatgac    282360
     cgccaagctc gtcgcgcagt tccgcgcccc cgcgcccgcc gctgtcgctg ttcctcagca    282420
     ggtcgacacg gcgcggctca cggtacgcga gcgcgagatc gttcaggaac tggcccgcgg    282480
     cgagagcaac aaggaaatcg cgcgcaccct gggcgtggct gcgagcaccg tgaagatcca    282540
     cgtgcagaac atcctgaaga agcttaacct cgccagccgc gtgcaggtcg ccgtctacgc    282600
     agtcgagcac cgcctgaccg aaactggctg aaccgtccgg cgccattgcg cgccgccccg    282660
     ccgcgcggcg tcctcatcct gttcctggac caggatcagt ccaccttcgg cgcgtcttcc    282720
     catccgcctg gcctcaattg gaagcaagta gcgcgcccct gtgacagttt ggagacagct    282780
     tcatcaacac gtcagcgggc tacccgcgtc agcatcagga atggggtctt aagcttgcat    282840
     cgtccccgcg aaggcgcggg cccaaccaac tcaaagacac tggatgcctg ccttcgtggg    282900
     caagaccatg gtgcaacgcc aactgaacgg cacttccgag gggctgttga cggtctcggc    282960
     gacctgccaa ctttggcccc ttgaacttcc acgcggtcaa cccggcttgc catccacccg    283020
     cggccgcatc agccgcggcg catacgtcag cgcatagagc ccgaacccgg ccacccagca    283080
     cagggccgcg ccgtagagcc agtgccggta tccggccggc cacagcagtg gcccgagcac    283140
     gcgcagtagc gcggcggcag ccaccagcca gtacgcgatg gtctcggcgc ggccggccac    283200
     cagcatgcgg ccggtatgac ccagcgccgt gcgcgtgatc atggcgatga tggcgccgcc    283260
     cagcacgccc acagtaaagg catgcgtggc gatgccgggc atccatagtc cgagcaccgc    283320
     tccggcctgc agcacgaatg ccagaggcag ccacgcatag gccaggtgca gcacccacag    283380
     cagcggccgg ttgcccaccg catggccgcg ccagccccac acgcgaattc ccagcacgaa    283440
     cgccgccaat agtgacagca cggcgcctag ccagccgggc aaaggaagca gcccggccgc    283500
     cagtcccagc acacccgccg gcaccactgc gcggtcgacg ttgcggtact gccgcaggcg    283560
     gaaaccggga atcgcgttgg tcgtgaacat cggaatcacc cgcccgccaa tcacgatcac    283620
     gaacagggag atgagcgcca cgccggcctg gcaagcgcgc agcgcgccat cggtctgccc    283680
     ttgcgattgc agccagaggc tgacgatgtt cgcggctgcc agcagccata gtgccagcgc    283740
     cagcggatag ttacgccggc tgccgccttt caccagcgcg cgcgtgaagg ccagcgcggc    283800
     cagcggcagg aacgcaccgt cgatcaccag cgccgcctcg cccgacgcgg tccacatcgc    283860
     gatacgcccc gccagccaca gcaggaacag gcaggccagc agcggcccgg tcggtgtcgg    283920
     ctggccggtc catgcacgcc cagcggtgaa cagaaagcca atcacgatgg ccaccgcaaa    283980
     gccaaacacc atctcatgcg catgccacag catcggcggc agcgatgccg aggatcccac    284040
     gctggtgatg cccgccagca tcgcggccca aagcgcaatg gcaacggcgc tgaatattgc    284100
     gccgcccagg tagaagggcc ggaaacccag cgcgaagagg gcaaagccgc gcggtggcgg    284160
     cccggcctcc ggcgatttgc gtggaccgcg cgcgggcagg atgggaatgg tttccatagt    284220
     gggagtaact ccccttcgtt gatcccggac aaaggtccgg tctggacaca ggctggctgc    284280
     gagcacgata gcaccgcctg ccgcctggtg tcctcccccg atggaactac ctccaccggc    284340
     aggttcttcc ccgcccctgg ctgtgctccc ggcgaatgtt caagcgatgt ggcggcccct    284400
     acgctggcag cacccgtcaa agttgacaca ggagcatggc catggccacc ccacatcccg    284460
     cgcgggcgcc gatcccgccc ggtgcctata cgacgctggc atccagcact ttcgccttca    284520
     ccatctgctt tgccgtctgg atgctgttcg cggtgctcgg cattccgctc aagaaggaac    284580
     tcggcctgaa cgacaccgag ttcgggctgc tggcggcaac gccagtcctg agcggctcgc    284640
     tgatccgcgt gccgctaggc ctctggaccg accgctacgg cggccgcatc gtcttcttcg    284700
     tgctgatgct ggccaccgtg atcccgatct ggctgatctc gtacgcgcac agcctgtggc    284760
     aactgctggt gctgggcctg ttcgtcggcc tggccggcgg ctcattctcg gtgggcacgc    284820
     cgtatgtggc gcgctggttc ccgcgctcgc gccagggcct ggcgatgggc atcttcggcg    284880
     ccggcaactc gggcgcggcg ctgaccaagt tcgtcgcgcc ggcgatgatc ctggccgccg    284940
     gcacttggga aatcgtgccg cgcgtctatt cgctggcgat gctcgccacc gcgctggtgt    285000
     tctgggtgtt ctcgcgcagc aaccccgcgc acctggtcaa gtccagcacc ggctggcgcg    285060
     agcagctttc catgctgcgc gacccgcgcg tgtggcgcta ctcgcagtac tactcggtgg    285120
     tgttcggcgg ctacgtgggc ctgtcgctgt ggatgaccaa gtactacatc ggcgaatacg    285180
     gtttcgacat caagaccgcc gccttcctgg ccgcctgctt ctcgctgccc ggcggcgcgc    285240
     tgcgtgccat cggcggctgg atctccgacc gctacggcgc gcaccgcacc acctggtggg    285300
     tgatgtgggt gagctgggtc ggcttcttcc tgctgagcta tccgcagacg gacttcatcg    285360
     tccagaccac cagcggtccg caggggttcc gcatcgcgct gacgcccacg gtgttcacct    285420
     tgctgctgtt cgtggtcggc atcgccttcg ccatcggcaa ggcctcggtg ttcaagttca    285480
     tctccaacga cttcaaccac aacatcggcg cggtttccgg cgtggtgggc ctggctggcg    285540
     ggctgggtgg ctttgtcctg cccattctgt tcggcatgct ggccgacctc accggcatcc    285600
     gcagcagctg cttcatgctg atgtacggca ccgtgtgcgt gagcctggtg tggatgcact    285660
     acagccaccg caccgaacgc cagcgcaagg aacaggcagt gggcctgacc cagccggcct    285720
     gacgaccctt cacataacgc caccaaccaa cgcacaccat catgtctacc tccgtactca    285780
     cccgctggga gcccgagaac gcggccttct ggcaaagcaa aggcgaacgc atcgcctatc    285840
     gcaacctcgg gatctcgatt ccggcgctga tgctggcttt cgtggtctgg atgctgtgga    285900
     gcgtggtcgc ggtcaacctc gaccgcgccg gcttccagtt caccaagaac cagctgttct    285960
     ggctgaccgc gctgccggcg ctgtccggcg ccacgctgcg catcttctat tccttcctgg    286020
     tgccggtgtt cggcgggcgc cgcttcaccg cgatctccac cgcgctgctg ctaatcccgg    286080
     cgctgggcat gggctttgcg ctgcgcgacc cgtccaccgg ctacccgacg ctgctggtgc    286140
     tggcgctgct gtgcgggctg ggcggggcca acttcagctc atcgatggcc aatatcagct    286200
     tcttcttccc caaggcgaag aaggggctgg ccaccgggct caacgcgggc atcggcaacc    286260
     tgggggtgtc ggtggtgcag ttcgtcacgc cgctggtagt gtcggtggcc atcttcggcg    286320
     cgcttggcgg cgagccgcag caattcccgg ccaacgaggc caacggcacc acgcagagtc    286380
     tgtggctgca gaacgccggc ttcatctggg tgccgttcat cgtggtatcg gcgctggcgg    286440
     cgtggttcgg catgcacgat atcgccgatg ccaaggcatc gttcgccgaa caggccgtga    286500
     tcttcaagcg caagcacaac tggctgatgt gctggctgta cgtgggcacc ttcggttcgt    286560
     tcatcggctt ctcggccggg ctggcactgc tgaccaagtc gcagttcccg ggcgtgaacc    286620
     cgaccgccta tgccttcctc gggccgctgg tgggcgcgct cacgcgcccg gtgggcggct    286680
     ggatctcgga caagctcggc ggcgcacgcg tcacgctgtg gaccttcgcc ggcatgatcg    286740
     ccgcggtgtt cgcggtgctg gcagcgctgc cgcatgacgg cgccggcggc aacttcatgt    286800
     acttcctggc ggccttcgtc gcgttgttcg cgctgaccgg catcggcaac ggctcgacct    286860
     tccgcatgat cccggtgatc ttcctgaccg agcgccagcg cgctgccgcc ggcaagggcg    286920
     acgtggcgca gaagcaggcc ctgcaggaag ccggcaagga atccgccgcc gtgctgggct    286980
     tctccggtgc gatcggcgcc tacggcggct tctttatccc caagagcttc ggcacctcgc    287040
     tggagctgac cggcgccgcc gacgccgcgc tgtattgctt tatcgccttc tacctcagct    287100
     gcgtgctggt gacgtggtgg cactacgcgc gccgcaacgc gcccatgcct tgctaacagc    287160
     cgccggccgg actagttcca tcgaactagt ccgccctccg tcacctagcc cgaccggcgt    287220
     gcggcgcctg ttccaccagc gaattggcgc cgccgccctc cccccttaag ctgagcgtgt    287280
     ccctgcaaac gctcccgcaa ccgccggagc ccccgcagca aagcactcgc ggagaacaaa    287340
     gcaatgagtc atttcctgga tcgactgaag ttcatgtcgc gcgtcaagtc cacctatgcg    287400
     gacggccacg gcgcggtggt gaacgaagac cgcaagtggg aagacggcta ccgcagccgc    287460
     tggcagcacg acaagatcgt gcgctccacc cacggcgtga actgcaccgg ctcctgctcg    287520
     tggaaggtct acgtgaagaa cggcctgatc acgtgggaga cccagcagac cgactatccg    287580
     cgcacgcgcc cggacctgcc caaccatgaa ccgcgcggct gcccgcgcgg cgcctcgtac    287640
     agctggtacg tctactccgc gcagcgcgtc aagtacccga tgatccgcgg ccgcctgatg    287700
     gagatgtggc gcgaggcccg caagaccatg gaccccgtcg ccgcgtggga atcggtcagc    287760
     caggacccgg tcaaggccgc gcgctacaag agcgtgcgcg gcctgggcgg cttcgtgcgt    287820
     gcggactgga acacggcgac cgagatgatc gcggcggcca atgccttcac cgtgaagaag    287880
     ttcggcccgg accgcgtgat cggcttctcg ccgatcccgg ccatgtcgat ggtgtcgtat    287940
     gccgccggtg cacgctacct gagcctgctg ggcggcgcct gcctgtcgtt ctacgactgg    288000
     tactgcgacc tgccgccggc cagcccgcaa gtgtggggcg agcagaccga cgtgcccgaa    288060
     tctgccgact ggtacaactc cacctacctg atggtgtggg gctccaacgt gccgcagacg    288120
     cgcacgcccg acgcgcactt ctacaccgag gtccgctaca agggcaccaa gaccgtggcg    288180
     gtctcgtccg acttcggcga gatggtcaag ttcggcgaca tctggctggc gccgaagcaa    288240
     ggcaccgacg ccgcgctggc gatggccatg ggccacgtgg tgctgaagga attccacgcc    288300
     agcggcaagt ccgcctactt ccgcgactac gtgaagcagt acaccgacat gccgatgctg    288360
     gtgctgctgc gcaagaacga cgaccaccag ggcacgctgg tgccggatca cttcctgcgc    288420
     gcgtcgcacc tggccaataa cctcggcgaa gccaaccatc ccgaatggaa gaccctgcag    288480
     attgacgacg ccaccggcga gatcgtcgcg cccaacggct cgatcggctt ccgctggggc    288540
     gaaggcgccc acaacggcgg cgaaaaggtc ggccgctgga acctggaaat gaaggacggc    288600
     ggcagcggcc gcacggtcga cccgcgcctg tcgctggtca gctatgccga tgaagtcgtt    288660
     gaagtcggct tcccctactt cggcggcgag cacgatgagc tgctgcgccg ccgcgtgccg    288720
     gcgcgccggc tgacgctggc cgacggcagc accgcgctgg tggccaccgt gtacgacctg    288780
     caaatggcca actatggcgt ggatcagggc ctcggcggcc cgaacgtggc cgcgtcgtat    288840
     gaagacgatg tgccctacac ccccgcctgg caggaaaagc acacctccgt cccggcccgt    288900
     ctggtgacgc aggtagcgcg cgagttcgcc gacaacgccg accgcacgca gggcaagagc    288960
     atggtgatcg tcggtgccgc actcaaccac tggtaccaca acgacatgat ctaccgcggc    289020
     atcatcaacc tgctgatgat gtgcggctgt atcggcaaga gcggcggcgg ctgggcccac    289080
     tatgtcggcc aggaaaagct gcgcccgcag ttcggctggg ccccgctcgc cttcggcctg    289140
     gactggtcgc gcccgccgcg ccagatgaac ggcacctcgt tcttctacaa ccacaccagc    289200
     cagtggcgcc acgaaaagct gggcgtcgac gagatcctgt cgccgaccgc cgaccgcaag    289260
     cgctatgacg gcctttcgct gctggacctg aacgcgcgct ccgaacgcat gggctggctg    289320
     ccctcggccc cgcagctggg cgccaatccg ctcgacgtgg tcgatgccgc cgagcgcaac    289380
     gggcaggacc ctgtggccta cacggtcgag caactcaagt ccggcaagct gcagttcgcc    289440
     tgcgacgacc ccgacaaccc ggccaacttc ccacgcaata tgttcgtgtg gcgctccaac    289500
     atcctgggca gctcgggcaa ggggcatgag tacttcctga agtacctgct gggcacgcag    289560
     aacgccgtgt tcggcgacga gaacgatgcg atcacgccga gcgaggtcaa cgtgcgcccg    289620
     gccgccgaag gcaagctgga cctgctgacg gtgctggact tccgcatgag caccacctgc    289680
     ctgtacggcg acatcgtgct gccgacggcg acctggtacg agaaggacga cctcaacacg    289740
     tccgacatgc acccgttcat ccacccgctg tccgaagccg tgcagccgct gtgggaaagc    289800
     aagaccgact gggagatcta caaggccatc gcgaagaagt tcagcgagat tgccggcccg    289860
     tatctgggca cgcgcaagga cctggtgtgc acgccgctgc tgcacgacac cccgggcgag    289920
     ctgggccagc ccttcgaacc caaggactgg aaggccggcg aatgcgacct gatccccggc    289980
     aagaccgcgc cgtcgatgac cgtggtggag cgcaactacg cggacctcta caagaagttc    290040
     acctcaatcg gcccgctgct ggacaagctc ggcaatggcg gcaagggcat caactggaat    290100
     acccagcatg aagtgaagga gatcggccag ctcagccaca ccgtgcagga gccgggcgtg    290160
     agccagggcc ggccgaagct ggaaaccgcg atcgatgcag ccgagatgat cctgaccttc    290220
     gcgcccgaga ccaacggcca cgtcgccgtc aaggcctggg aggcgctgtc gaagatcacc    290280
     gggcgcaacc acacccacct ggccgagggc cgcgagcacg acaagatccg cttccgcgac    290340
     gtgcaggcgc agccgcgcaa gatcatctcc gcgccgacgt ggtcgggact ggaatcggaa    290400
     gaggtcagct acaacgccgg ctacaccaac gtgcatgagc tgatcccctg gcgcacgctg    290460
     accgggcgcc agcagttctg gcaggaccac cgctggatgc tggacttcgg cgaaggggcg    290520
     tgcgtgtaca agccggccat cgacaccaag acggtggcgc cgatgctggg caagaagccc    290580
     aacggcaacc cggaactggt gctgaactgg atcacgccgc accagaagtg gggcatccac    290640
     tccacctact cggacaacct gcgcatgctg acgctgtcgc gcggcggccc gcacgtgtgg    290700
     atctcggaaa ccgaggccaa ggccaacggc atccgcgaca acgactgggt cgaggtcttc    290760
     aacgtcaatg gcacgctgac ggcccgcgtg gtggtgtcgc agcgcgtgcc caagggcatg    290820
     tgcctgatgt accacgccca ggaaaagatc gtgaacgtgc ccggcgccga gaccagcggc    290880
     atgcgcggcg gcatccataa ctcggtcacg cgcgccgtga ccaagcccac ccacatgatc    290940
     ggcggctacg cgcagctggc ctacggcttc aactactacg gcaccgtggg cagcaaccgc    291000
     gacgagttcg tgatcctgcg caagatgaag aaggtcgact ggctggaagg gccgctcgtg    291060
     gaaaagactg cgaagttgac tgtgaatgaa ggagcctcgc aatgaagatc cgtgcccagg    291120
     tggccatggt gctgaacctc gacaagtgca tcggctgcca tacctgctcc gtgacctgca    291180
     agaacgtctg gaccagccgc gacggcgtcg agtacgcctg gttcaacaac gtcgagacca    291240
     agcccggcat cggctacccc aaggaatggg agaaccagga caagtggcag ggtggctgga    291300
     agcgcaacgc cgacggcacg ctggagccgc gccagggcgg caagctgaag atcctcgcga    291360
     acctgttcgc caaccccaac ctgccggcga tcgacgagta ctacgagccc ttcacctacg    291420
     actacgagca cctgcagaag gcgccgctgg tccagacccc gcccaccgcg cgcccggtgt    291480
     ccgtgctgac cggccgcaag atggaaaaga tcgaatgggg cccaaactgg gaagacgacc    291540
     tcggcggcga gttcagctcg cgcggccgcg acaagctctt cgacaacgtg cagaaggaga    291600
     tgtactcgac cttcgagaac accttcatga tgtatctgcc gcgcctgtgc gagcactgcc    291660
     tgaacccggc ctgcgtggcc tcgtgcccgt cgggctcgat ctacaagcgc gaggacgacg    291720
     gcatcgtgct ggtcgaccag gacaagtgcc gcggctggcg catgtgcatc tcgggctgcc    291780
     cgtacaagaa gatctacttc aactggcaga gcggcaaggc cgagaaatgc ctgttctgct    291840
     atccgcgcat cgaggccggc cagcccacgg tctgctccga gacctgtgtc ggccgcatcc    291900
     gctacctcgg cgtgatgctg tacgacgcgg accgcatcga gcaggccgcg tcggtggccg    291960
     atgagcgcga cctgtaccag tcgcagctcg acgttttcct cgatccgcac gatcccgcgg    292020
     tgcaagccga ggcgctgcgc cagggcatcc cgcaaagctg gctggatgcc gcgcgcaagt    292080
     cgccggtcta caagatggcg tgcgagtgga aggttgcctt cccgctgcac ccggagtacc    292140
     gcacgctgcc gatggtgtgg tacatcccgc cgctgtcgcc gatccagtcg gcggccgagg    292200
     ccggccacat gggcctgaac ggcgtgatcc cggacgtgaa gagcctgcgc atcccggtca    292260
     ggtacctggc caacctgctg accgcgggcg acgtgatgcc ggtgctgtcg gcgctggacc    292320
     gcatgctggc gatgcgcgcc tacaagcgct cgcaggtggt ggacggcgtg caggacctgg    292380
     gcgtgctgga gcaggttggc ctgacgcccg cgcaggtcga ggacatgtac cagaccatgg    292440
     ccatcgccaa ctacgaggac cgcttcgtga tcccgtcctc gcacaaggag atggtcgagg    292500
     acagcttcaa cgacaaggcc agttgcggct tcaccttcgg caacggctgc tcgggcggca    292560
     cctcggaggg cgcgctgttc ggcaagaagc cgcagggcag cgtccacttt gtcgacatgc    292620
     ccaagtcgcg caagaaagcc gtgatgagct gagcgcgtgc ccgcatccac gaatcgcccg    292680
     gagaagacca tgcccctcta tcccatcctc agcgccctgt tcggctatcc cgagcaggat    292740
     ctgctggacg ccctgcccga gatcgatgcc gcgctggccg aatggccgca ggtgcgcgac    292800
     ctgctggccc ccgtgaccga cctgctgcgc agcgagtcgc tgatcgcgct gcaggagaac    292860
     tacgtcgcca ccttcgaccg caacccggcg cactcgctgc acctgttcga gcacgtgcac    292920
     ggcgaaagcc gcgaccgcgg ccaggccatg gtcgacctga tcgacgagta ccggcgcgaa    292980
     ggctttgaac cggcggcgtc cgaactgccc gactacgtgc cgttgttcct ggagttcctc    293040
     ggcgcgctgg tggccgacgg caaggaagcg cgcgccgaac agctgctggg cgaagcgatc    293100
     cacgtgctgg ccgccatcgg cgagcgcctg gcgcgcaatc aaagcccgta cgccggcgtg    293160
     ttcgcggtgc tgcgcacgct gaccgacgtg cagccacaac cgcagcagga gccgccggtg    293220
     cgcgacatgg acgaggcgct ggaaaccttc gggccggggg ccgatggcgt ggaaccgctg    293280
     ctggccccgc aggccgggcc gcaggcggtg aagttctatc cgcgcgatcc gcgggccaag    293340
     gcgccagtgc cggctgcctg ctgacagggc atggcaatgc aaaccgaaca ccagacaatg    293400
     ggttaacaca ccatggcaac gctccaccaa ttcctcttcg gcatctaccc gtatatcgct    293460
     gccgccatct tcctgttcgg cagcctggcg cgcttcgagc gcgagcagta cacctggaag    293520
     accgacagct cgcaggtgct gtaccgaggc aacctgcgca ccggcaacat cctgttccac    293580
     gtgggcatcc tgggcctgtt cttcgggcac ctggtgggcc tgctgacgcc ggtggcggtg    293640
     tgggatgcgc taggcgtctc gcacggcttc aagcagggcg tggcgatggc cgccggcggc    293700
     gtgatgggca ccatgtgcct ggccgggctg ctgatcctgc tgcaccgccg cctgaccaac    293760
     gcccgcgtgt cggccgtcac ccgcaccggc gacaaggtgc tgctgctgtg gctgctggtg    293820
     acgctgctgc tgggcctgtc caccatcttc gaatccgcca gccacatgga cggccacatg    293880
     atggtgcagc tgatgacctg ggcgcagcac atcgtcacgc tgcgcggcga cgccgccagc    293940
     tatgtcgcgg atgcgccgct gctgttcaag gcgcacctgt tcatgggcat cacgctgttc    294000
     gcgatcttcc cgttcacgcg gctggtgcat gtgtggagcg gctttgcctc ggtcggctac    294060
     ctcggccgtg cctggcaact ggtgcgtagc cgctgagcgc cgcaacccca caaggagaac    294120
     agcatgcctg tcaccgtcaa cggcgtggaa ctgcgcgacg ccgacatcga acgcgagctg    294180
     gaccaccatc acgatgcggc caacccggcg cggctggcca ccatcgcggc catcctgcgc    294240
     caactggtgc gcactgaagc cgaccgcatc ggcctcgccg ccgaagggct ggacgacgac    294300
     gcactggcgc tggccctgct ggaacgcgag gccggcatcc ccgagccaga cgaagccagc    294360
     tgccgccgcc actacgacag ccggcccgag cgctttcgcg acggcgaatg ggtcgaggcc    294420
     gaccatatcc tgttccaggt cacgccgcgc gtgccgctgg acgcgctgcg cgagatcgcc    294480
     gcgcagacgc tggcgctggt gcgcggcgac ccctcgacct ttgccgagca tgcccgggcg    294540
     ctgtccaact gccccagcgg cgtcaacggc ggccgcctgg gccgcgtatt ccgcggcgag    294600
     accgcaccgg agttcgagcg cgcgctgttc ggggcgctgc aggacggcgt actgccgcaa    294660
     ctggtcgaaa cccggttcgg cctgcatatc gtgcgcatcc tcgagcgcta ccccggcacg    294720
     cgcctgccct tcgacgcggt gcgcggcgat atcgcccgcg ccctcgcagc cgccgcgcgc    294780
     gaccgcgcct ggaagcagta tgcaagcctg ctgatcggcc gtgcccgcat cgatggcatc    294840
     gaactggaag gcgcggacag cccgctggtg cagtagtgcc ggcgattagg ccgtacagga    294900
     gcccgacctg catcagggca ctctgccctt gcaagcgccc gcccgctcaa aactcgcgga    294960
     cagcaccctg cggccgggct gtgcgctcac gtcccacaca cagagt