(data stored in ACNUC15260 zone)

EMBL: AY308915

ID   AY308915; SV 1; linear; genomic DNA; STD; MAM; 642 BP.
XX
AC   AY308915;
XX
DT   15-OCT-2003 (Rel. 77, Created)
DT   09-APR-2004 (Rel. 79, Last updated, Version 2)
XX
DE   Canis familiaris isolate cOR3A13 olfactory receptor family 3 subfamily A
DE   gene, partial cds.
XX
KW   .
XX
OS   Canis lupus familiaris (dog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; Canis.
XX
RN   [1]
RP   1-642
RX   DOI; 10.1016/j.ygeno.2003.08.009.
RX   PUBMED; 14962662.
RA   Olender T., Fuchs T., Linhart C., Shamir R., Adams M., Kalush F., Khen M.,
RA   Lancet D.;
RT   "The canine olfactory subgenome";
RL   Genomics 83(3):361-372(2004).
XX
RN   [2]
RP   1-642
RA   Kalush F.;
RT   ;
RL   Submitted (28-MAY-2003) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; 73f710481188fa0c92ec58fe6c3a7543.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..642
FT                   /organism="Canis lupus familiaris"
FT                   /isolate="cOR3A13"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9615"
FT   mRNA            complement(<1..>642)
FT                   /product="olfactory receptor family 3 subfamily A"
FT   CDS_pept        complement(<1..>642)
FT                   /codon_start=3
FT                   /product="olfactory receptor family 3 subfamily A"
FT                   /note="TM2-TM7 region"
FT                   /db_xref="GOA:Q6W6U2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q6W6U2"
FT                   /protein_id="AAQ95533.1"
FT                   /translation="FLSNLSLLDIGCITVTIPPMLACLLAHLCRVPYAACISQLFFFHL
FT                   LAGVDCHLLTAMAYDRYLAICQPLTYSTRMSREVQGALVGICCTISFINALTHTVAISV
FT                   LDFCGPNVINHFYCDLPPLFQLSCSSIHLNGKLLFVGATFMGVFPMILISVSYAHVTAA
FT                   VLRIRSAEGRKKAFSTCGSHLTVVCIFYGTGIFSYMRLGSASVSDKDKGI"
XX
SQ   Sequence 642 BP; 193 A; 140 C; 191 G; 118 T; 0 other;
     caatcccctt gtccttatct gaaactgacg ctgagcccag acgcatataa ctgaagatgc        60
     cagttccata aaagatacaa accacggtga ggtgagaccc acatgtagag aaggccttct       120
     tcctcccctc tgctgagcgg attcgtagca ctgcagctgt aacgtgagca taagacactg       180
     agatgaggat catggggaac actcccatga aagtggctcc cacaaaaagc agcttcccat       240
     tgaggtggat gctggagcag gagagctgga ataggggtgg gaggtcacag tagaagtggt       300
     tgatcacatt agggccacag aagtcaagca cagatatagc cactgtatga gtcaaagcat       360
     tgataaagga aatggtgcag caaatgccca ccaaggcacc ctggacttca cggctcatgc       420
     gggtgctgta ggtgaggggc tgacagatgg ccaggtagcg gtcataggcc atggctgtca       480
     ggaggtgaca gtcaacacca gccaggaggt ggaaaaagaa gagctgtgaa atgcaggcag       540
     catagggaac tctacacagg tgggccagga gacatgctag cattggaggg atggtgacag       600
     tgatgcatcc aatgtccagc agagataagt tagagagaaa ca                          642
//

If you have problems or comments...

PBIL Back to PBIL home page