(data stored in ACNUC7820 zone)

EMBL: AY308944

ID   AY308944; SV 1; linear; genomic DNA; STD; MAM; 580 BP.
XX
AC   AY308944;
XX
DT   15-OCT-2003 (Rel. 77, Created)
DT   09-APR-2004 (Rel. 79, Last updated, Version 2)
XX
DE   Canis familiaris isolate cOR7G14 olfactory receptor family 7 subfamily G
DE   gene, partial cds.
XX
KW   .
XX
OS   Canis lupus familiaris (dog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; Canis.
XX
RN   [1]
RP   1-580
RX   DOI; 10.1016/j.ygeno.2003.08.009.
RX   PUBMED; 14962662.
RA   Olender T., Fuchs T., Linhart C., Shamir R., Adams M., Kalush F., Khen M.,
RA   Lancet D.;
RT   "The canine olfactory subgenome";
RL   Genomics 83(3):361-372(2004).
XX
RN   [2]
RP   1-580
RA   Kalush F.;
RT   ;
RL   Submitted (28-MAY-2003) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; e9ecf6418faa1eb95a9f495640743022.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..580
FT                   /organism="Canis lupus familiaris"
FT                   /isolate="cOR7G14"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9615"
FT   mRNA            <1..>580
FT                   /product="olfactory receptor family 7 subfamily G"
FT   CDS_pept        <1..>580
FT                   /codon_start=1
FT                   /product="olfactory receptor family 7 subfamily G"
FT                   /note="TM2-TM7 region"
FT                   /db_xref="GOA:Q6W6S3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q6W6S3"
FT                   /protein_id="AAQ95552.1"
FT                   /translation="YTGCLTQIYFILVFASLESFLLSVMAYDRYVAICHPLRYTVIMNS
FT                   HLCGLLILLSLCINIVDALMHSLMVLQLSFCTDLEIPLFFCEVVQVIKIACSDTLINNI
FT                   LIYFATSVFGGIPVCGIIFSYTQIVSSVLRMPSTGGKYKVFSTCGSHLSVVSLFYGTGL
FT                   GVYISSALTSSSRNTAVVSVMYTIVPQMLN"
XX
SQ   Sequence 580 BP; 121 A; 138 C; 116 G; 205 T; 0 other;
     tacacaggct gcctcacaca gatctacttt atcctggttt ttgctagttt ggaaagtttt        60
     cttctttcag taatggccta tgaccgctat gtggccatct gtcatccact gaggtacacg       120
     gtcatcatga actcccacct ttgtggcctc ttaattctac tctctttgtg cattaacatt       180
     gtggatgccc tgatgcacag tctgatggtg ttgcaactgt ccttctgcac agaccttgaa       240
     atccctctct tcttctgtga agttgttcag gtcatcaaga ttgcatgttc tgacaccctc       300
     atcaataaca tcctgatata ttttgcaact agcgtatttg gtggtatccc tgtgtgtgga       360
     atcattttct cctatactca gatagtgtct tctgttttga gaatgccatc aacaggtgga       420
     aagtataaag ttttttccac ctgtgggtct cacctctctg ttgtgtcctt gttctatgga       480
     actggtttgg gggtgtacat tagttctgct cttactagct cttccagaaa cactgcggtg       540
     gtttcagtga tgtacactat tgtcccccaa atgctgaacc                             580
//

If you have problems or comments...

PBIL Back to PBIL home page