(data stored in ACNUC7820 zone)

EMBL: AY317343

ID   AY317343; SV 1; linear; genomic DNA; STD; MUS; 960 BP.
XX
AC   AY317343;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr257 (Olfr257) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-960
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-960
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; 5ceea1af19558799e4d26f8796986b2e.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..960
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>960
FT                   /gene="Olfr257"
FT                   /note="synonyms: GA_x6K02T2N22H-3824-2865, MOR160-3,
FT                   GA_x5J8B7W76D0-7743435-7742476"
FT   mRNA            <1..>960
FT                   /gene="Olfr257"
FT                   /product="olfactory receptor Olfr257"
FT   CDS_pept        1..960
FT                   /codon_start=1
FT                   /gene="Olfr257"
FT                   /product="olfactory receptor Olfr257"
FT                   /db_xref="GOA:Q7TS21"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TS21"
FT                   /protein_id="AAP70812.1"
FT                   /translation="MRNFSVASEFILLGLSEDAQVQALLFVAFLVIYVLTLTGNSMILL
FT                   VIRVDAHLRSPMYFFLGHLSFLDLLYSSVSTPKMLENLVSETKTIPVKGCLAQAFFVFA
FT                   IGGTEALLLAVMAYDRYAAICHPLLYGQMMSDWFCQVLVWGSWILAILNSLINTLLAVS
FT                   LDFCHYGTIHNYNCEFPSLFPLSCSDVSTNATAIVCSFVIHASGTFLLVVGSYGCIFST
FT                   ILNMSSTRGRSKAFSTCSSHLTVVMLYFGSACLRYVMPTSGSPVEMYFSVQYSVITPML
FT                   NPFIYSLKNQEVKAAMRKLLARCYQHFGDVDQRHRDKC"
XX
SQ   Sequence 960 BP; 185 A; 264 C; 221 G; 290 T; 0 other;
     atgaggaact tcagtgttgc ctctgagttc atcctccttg gtctgtctga agatgcacag        60
     gtccaggctc tactctttgt ggctttcctt gtgatctatg tcctgaccct gacagggaac       120
     tccatgattc tgttggtgat aagggtggat gctcacctcc gctctcccat gtactttttt       180
     ctgggtcacc tctccttcct ggatcttttg tattcatcag tctccacacc caagatgctg       240
     gagaatctgg tgtctgagac aaaaaccatc cctgtgaagg gttgtctggc ccaggccttc       300
     tttgtgtttg ccattggggg taccgaggct ttgcttcttg ctgtcatggc ctatgatcga       360
     tatgcagcca tttgccaccc tctactctat ggtcagatga tgagtgactg gttctgccag       420
     gtgctagtgt ggggatcctg gatcctggcc atcctgaact cactcattaa taccctccta       480
     gctgtgagtt tggacttttg tcactatgga accatacaca actacaactg tgagtttccc       540
     tccctcttcc ctctctcctg ctccgatgtc tccactaatg ccactgccat agtctgtagt       600
     tttgtcatac acgcctctgg aaccttcctt ctcgtggtag gttcttatgg ctgcattttc       660
     tccactatcc tgaacatgag ctccaccagg ggtaggagca aggcattttc cacctgctcc       720
     tcccacctca ccgtagtgat gttgtacttt ggttcggcct gcctgcgcta cgtcatgccc       780
     acctcaggtt ctccagtgga aatgtacttc tctgtgcagt acagcgtcat cacccccatg       840
     ctgaatccct ttatctacag tctgaagaac caggaggtga aggcggccat gagaaagctg       900
     ctggcaagat gctaccagca ttttggggat gttgatcaga gacacaggga caagtgttga       960
//

If you have problems or comments...

PBIL Back to PBIL home page