(data stored in ACNUC15260 zone)

EMBL: AY317388

ID   AY317388; SV 1; linear; genomic DNA; STD; MUS; 930 BP.
XX
AC   AY317388;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr295 (Olfr295) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-930
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-930
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; 374a67987bbf88848989a1719214c5a7.
DR   Ensembl-Gn; ENSMUSG00000059319; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032481; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032181; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_DBA2J_G0032299; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_LPJ_G0032388; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032986; mus_musculus_nzohlltj.
DR   Ensembl-Tr; ENSMUST00000078447; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215365; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084878; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084490; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_DBA2J_T0084615; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_LPJ_T0084645; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085704; mus_musculus_nzohlltj.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..930
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="7E1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>930
FT                   /gene="Olfr295"
FT                   /note="synonyms: GA_x6K02T2NHDJ-9539243-9538314, MOR220-1,
FT                   GA_x5J8B7W89HK-6195373-6194378"
FT   mRNA            <1..>930
FT                   /gene="Olfr295"
FT                   /product="olfactory receptor Olfr295"
FT   CDS_pept        1..930
FT                   /codon_start=1
FT                   /gene="Olfr295"
FT                   /product="olfactory receptor Olfr295"
FT                   /db_xref="GOA:Q7TS08"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030129"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TS08"
FT                   /protein_id="AAP70840.1"
FT                   /translation="MANSTLVPEFFLEVFAETWELRILLTVLFLLMYLGSLLGNLIIII
FT                   ATTVDQTLNTPMYFFLRNLSILDMGYVSVTVPNACINSLTDHRSISLAGCAGQIFLVFF
FT                   SACVEIQFLTIMAQDRYVAICKPLLYAMIMNHQFCVQMTLASLLTSLILASVHTSKTFQ
FT                   LSFCHSNVVSQFFCDIPSLLRLSCTDTFINKLLLLLTAIVFSGSCFTFIAISYVRILST
FT                   VLKVPVKGERGKAFSTCVPHIIVVSVFLSSGAYVYLKPSAISEIVEDMTLSVFYTIVPP
FT                   FLNPIIYSLRNKQIKKAVKKVIFRFFIV"
XX
SQ   Sequence 930 BP; 213 A; 213 C; 169 G; 335 T; 0 other;
     atggccaatt ccaccctggt gcctgagttc ttcctggaag tttttgctga gacttgggaa        60
     ctcaggatcc tactcactgt gctgttcttg ttgatgtacc tgggcagcct gttggggaat       120
     cttatcatca tcattgctac tacagttgac cagaccctga atacacccat gtacttcttc       180
     ctcaggaatc tgtctatttt agacatgggg tatgtatctg ttactgtgcc caatgcttgt       240
     atcaactctc tcactgatca caggagcatt tctttggctg ggtgtgcagg acagatcttt       300
     ttggttttct tttctgcatg tgtagagatt cagtttctca ccatcatggc ccaggaccgc       360
     tatgtggcca tctgtaagcc tcttctctat gctatgatta tgaaccatca attctgtgtt       420
     cagatgacac tggcttccct acttacctct cttatccttg caagtgtgca cacttccaaa       480
     actttccagc tatccttttg tcactctaat gtagtctctc agttcttctg tgatatcccc       540
     tctttgctga ggctttcttg cactgacacc tttatcaaca aactattact tcttctgact       600
     gccattgttt ttagtggtag ctgctttacc ttcattgcca tatcatatgt tcgcatatta       660
     tcaactgtct tgaaggttcc tgtcaaagga gagagaggaa aagccttttc cacctgtgtc       720
     cctcacatta ttgtggtgtc tgtgtttctt agttctggtg cctatgtata tttaaaacct       780
     tcagcaatct cagaaatagt tgaggatatg acactttctg tattttatac cattgttcct       840
     ccattcttaa accctattat ctatagtctt agaaacaaac agataaagaa ggctgtgaag       900
     aaagtaatat ttagattttt catagtttaa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page