(data stored in ACNUC15260 zone)

EMBL: AY317403

ID   AY317403; SV 1; linear; genomic DNA; STD; MUS; 999 BP.
XX
AC   AY317403;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr310 (Olfr310) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-999
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-999
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; fcd61d165a3b70a0444412d5a1c0dbe1.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..999
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="7E1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>999
FT                   /gene="Olfr310"
FT                   /note="synonyms: GA_x6K02T2NHDJ-9838699-9839697, MOR227-6P,
FT                   GA_x5J8B7W89HK-6487850-6488818"
FT   mRNA            <1..>999
FT                   /gene="Olfr310"
FT                   /product="olfactory receptor Olfr310"
FT   CDS_pept        1..999
FT                   /codon_start=1
FT                   /gene="Olfr310"
FT                   /product="olfactory receptor Olfr310"
FT                   /db_xref="GOA:Q7TS00"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TS00"
FT                   /protein_id="AAP70851.1"
FT                   /translation="MANSTLVTEFFLEVFAEIWELRILITVLFLLVYLCSLLGNLTIII
FT                   VTTVDQTLNTPMYFFLRNLSILDMGYISITVPSTCINSLTNHRNMSVAGCAAQIFSFLF
FT                   CACVEILFLSIMAQDRYVAICKPLLYPVIMNHQFCVQMTLASLLSSLVIASVHTFKTFQ
FT                   LSFCHSNVVPQFFCDLPALLRLSCSDTFSNKLLILLTVIGVSGSCFVFIAISYIHILST
FT                   VLKIPVKGERGKAFSTCVPHIIVVSVFVSSAAFVYLRPPVITFEVVQEMVISVFYTMVP
FT                   PFLNPIVYSLRNKQIKEAVRKVILRVFPIFEYKRNIYLSWYFRGKKTDKVR"
XX
SQ   Sequence 999 BP; 241 A; 229 C; 190 G; 339 T; 0 other;
     atggccaatt ccaccctagt gactgagttc ttcctggagg tttttgctga gatttgggag        60
     ctcaggatct taatcactgt gctgttcctg ctggtgtatc tgtgcagcct gttagggaac       120
     cttaccatca tcattgttac tacagttgac cagaccctga acacacccat gtacttcttc       180
     ctcaggaatc tgtccatttt agacatgggc tacatttcta tcactgtccc cagtacctgt       240
     atcaactctc tcactaacca caggaatatg tctgtggctg ggtgtgcagc acaaatcttt       300
     tcgttcttat tttgtgcatg tgtagagatt ctatttcttt ccatcatggc ccaagaccgc       360
     tatgtggcca tctgcaagcc tctgctctat cctgtgatca tgaaccacca gttctgtgtt       420
     cagatgacac tggcttccct actcagctcc cttgtcattg caagtgtgca cactttcaaa       480
     actttccagc tgtccttctg tcactctaat gtggtccctc agttcttctg tgatctgccc       540
     gctttgctga gactttcttg ctctgacacc tttagcaaca aactcctaat acttctgact       600
     gtcattggag tcagtggtag ttgctttgtc ttcattgcca tatcatatat tcacatatta       660
     tcaactgtat tgaagattcc cgtcaaagga gagagaggga aagccttttc tacctgtgtt       720
     cctcacatta ttgtggtgtc tgtctttgtt agttctgctg cctttgtgta tctacgacct       780
     ccagtaataa cctttgaagt agttcaggaa atggttattt ctgtatttta taccatggtt       840
     ccaccattct taaacccaat tgtctatagt cttagaaaca aacagataaa ggaggcagtg       900
     aggaaagtta tattgcgagt ttttcccata tttgaatata aaaggaacat ctatttgtca       960
     tggtatttta gagggaaaaa aactgataaa gtaagataa                              999
//

If you have problems or comments...

PBIL Back to PBIL home page