(data stored in ACNUC7820 zone)

EMBL: AY317502

ID   AY317502; SV 1; linear; genomic DNA; STD; MUS; 936 BP.
XX
AC   AY317502;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr399 (Olfr399) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-936
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-936
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; 808956183c9e98ea4cf11c7ab5288b43.
DR   Ensembl-Gn; ENSMUSG00000043692; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018683; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018650; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018619; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018623; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018436; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019074; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017991; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018407; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018515; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018505; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018586; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018531; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019114; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017762; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018044; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000059440; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215915; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0030608; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0030546; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0030523; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0030540; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030336; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031049; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030044; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0030250; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0030383; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0030381; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0030505; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030368; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031071; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0029760; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0029823; mus_musculus_wsbeij.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..936
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="11B3-11B4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>936
FT                   /gene="Olfr399"
FT                   /note="synonyms: GA_x6K02T2P1NL-4211516-4210581, MOR255-1,
FT                   GA_x5J8B7W3YLM-7346099-7347034"
FT   mRNA            <1..>936
FT                   /gene="Olfr399"
FT                   /product="olfactory receptor Olfr399"
FT   CDS_pept        1..936
FT                   /codon_start=1
FT                   /gene="Olfr399"
FT                   /product="olfactory receptor Olfr399"
FT                   /db_xref="GOA:Q7TRX3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030233"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRX3"
FT                   /protein_id="AAP70925.1"
FT                   /translation="MDLGTLGNDSCVSTFVLLGLTETPVLRPILFVIFLLAYVATLGGN
FT                   FSILAAIIIEPKLHTPMYFFLGNLSMLDVGCISVTVPAMLKHFLSNDRHIPYGACLSQL
FT                   FFFHLLAGADCFLLTVMAYDRYLAICHPLTYNTHMSWRIQKASVCLSCVFSFSNALTQT
FT                   VALSTLKFCGPNTINHFYCDLPQLFQLSCSSIQLNEQLLFVAAAFMGVVPLVLITVSYG
FT                   HVAAAVLRIRSAEGRKKAFSTCSSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGIGILN
FT                   TVISPMLNPLIYSLRNPDVQGALRKVLTGR"
XX
SQ   Sequence 936 BP; 189 A; 260 C; 206 G; 281 T; 0 other;
     atggatctgg gaaccttggg aaacgattcc tgtgtgagca catttgtcct actgggtctc        60
     acagagactc cagttttgcg gcccatcctc tttgtcatct tccttcttgc ttatgtagct       120
     acgcttggtg gcaatttcag catcctggct gctatcatta tagagcccaa actccacact       180
     cccatgtatt tcttcttggg gaacttgtct atgctggatg ttggatgcat tagtgtcact       240
     gttcctgcca tgttgaaaca ttttctatcc aatgacagac acattcccta tggggcctgc       300
     ctctcacagc tcttcttctt ccatctcctg gctggggcag actgcttcct tctgactgtc       360
     atggcctatg atcgttatct ggctatctgc caccccctca cctacaacac ccatatgagt       420
     tggaggattc agaaggcctc agtgtgcctg tcatgtgtgt tttcctttag taatgcactg       480
     acccaaactg ttgccttatc tactcttaaa ttctgtggtc caaacacaat caaccacttc       540
     tactgtgacc tccctcagct ctttcagctt tcctgttcca gcatccaact caatgagcag       600
     ctgctctttg tagcagcagc cttcatgggt gtggtcccct tggtcctcat tactgtgtca       660
     tatggccatg tggcagctgc agttcttcgt atccggtctg ctgagggcag gaagaaagcc       720
     ttctctacct gcagctctca tctcactgtg gtaggcatct tctatgggac aggggtcttc       780
     agctacatgc gtctggggtc agtggaatct tcagacaagg acaaaggcat tggcatcctc       840
     aacactgtca tcagtcccat gctgaaccca cttatctaca gccttaggaa ccctgatgtg       900
     cagggtgccc tacggaaggt gctcacaggg aggtag                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page