(data stored in ACNUC15260 zone)

EMBL: AY317505

ID   AY317505; SV 1; linear; genomic DNA; STD; MUS; 948 BP.
XX
AC   AY317505;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   27-APR-2004 (Rel. 79, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor Olfr402 (Olfr402) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-948
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-948
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; 838d7d2640d3d68ddeac6715b2969d0f.
DR   Ensembl-Gn; ENSMUSG00000070379; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018686; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018652; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018622; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018626; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018439; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019077; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017992; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018410; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018518; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018508; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018589; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018534; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019117; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017763; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018046; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000073675; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216722; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0030614; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0030548; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0030529; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0030546; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030342; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031055; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030045; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0030256; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0030389; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0030388; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0030511; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030373; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031077; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0029761; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0029825; mus_musculus_wsbeij.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..948
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="11B3-11B4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>948
FT                   /gene="Olfr402"
FT                   /note="synonyms: GA_x6K02T2P1NL-4307199-4308146, mOR11-40b,
FT                   MOR255-4, GA_x5J8B7W3YLM-7252015-7251068"
FT   mRNA            <1..>948
FT                   /gene="Olfr402"
FT                   /product="olfactory receptor Olfr402"
FT   CDS_pept        1..948
FT                   /codon_start=1
FT                   /gene="Olfr402"
FT                   /product="olfactory receptor Olfr402"
FT                   /db_xref="GOA:Q8VFX8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030236"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFX8"
FT                   /protein_id="AAP70927.1"
FT                   /translation="MQTKPRINGTTITEFILLGLVETPELWPLVFILFLLAYMTTVGGN
FT                   LSILAAVLVEPKLHTPMYFFLGNLSVMDVGCISVTIPSMLVRLLVQKHTIPYGDCLTQL
FT                   FFFHLLAGVDCFLLTAMAYDRFLAICQPLTYSTRMNYTIQRILVAMSWACAFSNALTHT
FT                   VAISTLHFCGPNVINHFYCDLPQLFQLSCSSTQLNELLLFGVGFIMAGTPMALIFISYI
FT                   HVAAAVLRIRSAEGRKKAFSTCSSHLTVVAMFYGTGMFNYMRLGSTKFSDKDKAIGIFN
FT                   TVINPMLNPLIYSLRNPDVQAALWRVLTGRRPAA"
XX
SQ   Sequence 948 BP; 215 A; 261 C; 207 G; 265 T; 0 other;
     atgcagacaa agcctagaat caatggaacc actattactg aattcattct tctgggtttg        60
     gtggagacac cagagctgtg gccacttgtc ttcatactct tcctcttggc ttacatgaca       120
     acagttggag gtaacctgag catcctggca gctgtcttgg tggaacccaa actgcacact       180
     cccatgtact tcttcctggg gaatctgtca gtgatggatg tggggtgcat cagtgtcact       240
     attccctcca tgttggttcg gctcttggtc caaaagcata caattccata tggagactgc       300
     ctcacacagc tcttcttctt ccatctgctg gctggggttg actgtttcct gttgacagcc       360
     atggcttatg accgcttcct ggccatctgc cagcccctca cttacagcac ccgaatgaac       420
     tacactatac agaggatctt ggtggctatg tcctgggctt gtgcctttag caatgcactg       480
     acacacacag tagccatatc cacacttcac ttctgtggcc caaatgtaat caatcacttc       540
     tactgtgacc tgcctcagct cttccagctg tcctgctcca gtacccagct caatgagctg       600
     ctgctctttg gagtgggttt cataatggca ggaaccccta tggcactcat ttttatctct       660
     tatatccatg tggcagctgc agttctgcga attcgctctg ctgaaggcag aaagaaagct       720
     ttctccacat gcagctctca cctcactgtg gttgccatgt tctatggcac aggcatgttt       780
     aactacatga gactgggttc caccaaattt tcagataagg acaaagctat tgggattttc       840
     aacactgtca tcaaccctat gctgaaccca ctcatctaca gtctcaggaa ccctgatgtg       900
     caggctgccc tctggagggt actcacaggg agacggccag cagcttga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page