(data stored in ACNUC7820 zone)

EMBL: AY317633

ID   AY317633; SV 1; linear; genomic DNA; STD; MUS; 930 BP.
XX
AC   AY317633;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   27-APR-2004 (Rel. 79, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor Olfr525 (Olfr525) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-930
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-930
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; 80f7215323089dc1b482da22264c2471.
DR   Ensembl-Gn; ENSMUSG00000061489; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033173; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033155; mus_musculus_aj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033156; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032870; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033667; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032200; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032843; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032995; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032948; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033089; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032980; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033687; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031906; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032311; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000078103; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214594; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087398; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087484; mus_musculus_aj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087439; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087002; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0087943; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087529; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0086946; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087140; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0086986; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087171; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087022; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088241; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0086932; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086040; mus_musculus_wsbeij.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..930
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="7E3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>930
FT                   /gene="Olfr525"
FT                   /note="synonyms: GA_x6K02T2PBJ9-42472898-42473827,
FT                   MOR251-2, GA_x5J8B7W72BC-171390-170461"
FT   mRNA            <1..>930
FT                   /gene="Olfr525"
FT                   /product="olfactory receptor Olfr525"
FT   CDS_pept        1..930
FT                   /codon_start=1
FT                   /gene="Olfr525"
FT                   /product="olfactory receptor Olfr525"
FT                   /db_xref="GOA:Q8VGL5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030359"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGL5"
FT                   /protein_id="AAP71021.1"
FT                   /translation="MEINNYTTVVEFVLQGLSEDPGLQALFLAFFLLLYILALAGNTLI
FT                   IIAISLNSSLHTPMYFFLANLALLDIVCTSTVLPKLLEGLVGKSSHISYKGCMTQLFFL
FT                   TWFLGAELLLLTAMAYDRYVAICRPLHYSMLMSWPICVLLAGSVWVISAASTSVHTGLM
FT                   ARLNFCGPNQIRHFLCEVPTLLLLSCSPTTLNNIMIVIADVYFGVVNFLLTMISYSFII
FT                   TSILRIRSTEGKKRAFSTCSAHLVVVVLYYSTVIYTYLQPGSGSSLENGKVVALLYTAV
FT                   SPTLNPAIYSLRNKDVKVALKKLFPCFQ"
XX
SQ   Sequence 930 BP; 193 A; 275 C; 195 G; 267 T; 0 other;
     atggaaataa acaattacac aactgtggtg gagtttgtcc tgcagggact ctctgaggac        60
     cctgggctcc aggctctctt cttggccttt ttcttgcttc tttacatcct ggctcttgca       120
     ggaaacaccc tcatcatcat agccatcagc ctcaactcaa gccttcacac ccccatgtac       180
     ttcttccttg caaacctggc cctgttggac atcgtctgta catccactgt tcttcccaag       240
     ctgctggagg gtttggtggg taagagcagc cacatttctt ataagggatg catgacccaa       300
     ctctttttcc tgacctggtt tctaggggct gagctgctgc tgctcactgc catggcctat       360
     gaccgctatg tggccatctg tcgcccactg cactacagca tgctgatgag ctggcccatc       420
     tgtgtcctgc tcgccggcag tgtgtgggtc atcagtgcag ccagcacatc tgtgcacact       480
     ggcttgatgg cacgactcaa tttctgtggc cccaaccaaa ttcgtcactt tttatgtgaa       540
     gtcccaacac tgctgcttct gtcttgcagc ccaaccaccc tcaacaacat catgattgtc       600
     attgcagatg tttattttgg tgtggtcaac tttctgttga ctatgatatc ctatagcttc       660
     atcatcacca gcatcctgcg catccgctcc acagagggca agaagcgagc cttctctacc       720
     tgctctgccc acctggtggt ggttgtcctg tactactcca ccgtcatcta cacctatttg       780
     cagcctggct ccggatcctc cttggagaat ggcaaagtag ttgctttatt gtacacagca       840
     gtcagcccta ccctgaaccc cgccatttat tctctaagga acaaggatgt caaagttgcc       900
     ctcaaaaagt tatttccctg tttccaatga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page