(data stored in ACNUC7820 zone)

EMBL: AY317641

ID   AY317641; SV 1; linear; genomic DNA; STD; MUS; 930 BP.
XX
AC   AY317641;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   27-APR-2004 (Rel. 79, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor Olfr532 (Olfr532) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-930
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-930
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; b6c464ca1a682d60b49e546db83c549d.
DR   Ensembl-Gn; ENSMUSG00000063823; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033178; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033160; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033092; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033161; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032875; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033672; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032205; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032848; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033000; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032953; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033094; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032985; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033692; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031911; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032316; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000073226; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213801; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087403; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087489; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087425; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087444; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087007; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0087948; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087534; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0086951; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087145; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0086991; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087176; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087027; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088246; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0086937; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086045; mus_musculus_wsbeij.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..930
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="7E3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>930
FT                   /gene="Olfr532"
FT                   /note="synonyms: GA_x6K02T2PBJ9-42570051-42569122,
FT                   MOR251-1, GA_x5J8B7W1QYH-3213-2284"
FT   mRNA            <1..>930
FT                   /gene="Olfr532"
FT                   /product="olfactory receptor Olfr532"
FT   CDS_pept        1..930
FT                   /codon_start=1
FT                   /gene="Olfr532"
FT                   /product="olfactory receptor Olfr532"
FT                   /db_xref="GOA:Q8VGT4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030366"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGT4"
FT                   /protein_id="AAP71026.1"
FT                   /translation="MAINNSTTVVEFVLQGLSEDPGLQALFLAFFLLLYILALAGNTLI
FT                   IIAISLNPRLHTPMYFFLANLALLDIICTSTVVPKLLEGLVGKSSHISYKGCMTQVFFL
FT                   IWVLGAELLLLTAMAYDRYVAICRPLHYNTLMSWPICVLLAGFVWVIGIANTSVHIGLL
FT                   VRLNFCGSNQIRHFLCEVPTLLLLSCSPTTLNNIMLVIADVYFGVLNFLLTMISYSFII
FT                   SSILRIRSAEGKKRAFSTCSAHLVVVTLYYSTIIYTYLQPGSGSSFQNSKVVTLLYTAV
FT                   SPTLNPIIYSLRNKDVKVALKRLFPCFH"
XX
SQ   Sequence 930 BP; 194 A; 273 C; 189 G; 274 T; 0 other;
     atggcaataa acaattccac aactgtggtg gagtttgtcc tgcagggact ctctgaggac        60
     cctgggctcc aggctctctt cttggccttt ttcttgctcc tttacatcct ggctcttgca       120
     ggaaacaccc tcatcatcat agccatcagc ctcaacccaa ggcttcacac acccatgtat       180
     ttcttccttg caaacctggc cctgttggac atcatctgta cctccactgt tgttcccaag       240
     ctgctggagg gtttggtggg taagagcagc cacatttctt ataagggatg catgacccaa       300
     gtcttcttcc tcatctgggt tctaggggct gagctgctgc tgctcactgc catggcctat       360
     gaccgctatg tggccatctg ccgcccactg cactacaaca cactgatgag ctggcccatc       420
     tgtgtcctgc ttgcaggttt tgtgtgggtg attggcatag ccaacacatc tgtgcatatt       480
     ggcctgctgg tgcgactcaa tttctgtggc tccaaccaaa ttcgtcactt cttatgtgaa       540
     gtcccaacac tgctgcttct gtcttgcagc ccaaccaccc tcaacaacat tatgcttgtc       600
     atcgcagatg tttattttgg tgtgctcaac tttctgttga ctatgatatc ctacagcttc       660
     atcatttcca gcatcctgcg cattcgctca gccgagggca agaagcgtgc attctctacc       720
     tgctctgccc acctggtagt agtcaccctg tactactcca ccatcatcta cacctatcta       780
     cagcctggct ctggatcctc cttccagaat agcaaggttg ttaccttact gtacacagca       840
     gtcagcccta ccttgaatcc catcatttat tctctaagga acaaggatgt gaaggtagcc       900
     ctcaaaaggt tatttccctg ttttcattga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page