(data stored in ACNUC15260 zone)

EMBL: AY317649

ID   AY317649; SV 1; linear; genomic DNA; STD; MUS; 933 BP.
XX
AC   AY317649;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr61 (Olfr61) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-933
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-933
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; 5669560d9540b88d41c4888b4dc00332.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..933
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="7E3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>933
FT                   /gene="Olfr61"
FT                   /note="synonyms: GA_x6K02T2PBJ9-42783826-42784758, H7,
FT                   MOR253-1, GA_x5J8B7W3EKE-4605794-4604862"
FT   mRNA            <1..>933
FT                   /gene="Olfr61"
FT                   /product="olfactory receptor Olfr61"
FT   CDS_pept        1..933
FT                   /codon_start=1
FT                   /gene="Olfr61"
FT                   /product="olfactory receptor Olfr61"
FT                   /db_xref="GOA:Q7TRT3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRT3"
FT                   /protein_id="AAP71032.1"
FT                   /translation="MFSPNQTEVTEFILEGFSEHATLRLLLTGCFLSLYTIALMGNIVI
FT                   IALVTSSTGLHSPMYFFLCNLATMDIVCTSSVIPKALIGLVSEENTISFKGCMAQLFFL
FT                   LWSLSSELLLLTVMAYDRYVAICFPLHYSSRMSPQLCGALAVGVWSICAVNASVHTGLM
FT                   TRLSFCGPKVITHFFCEIPPLLLLSCSPTYINSVMTLVADAFYGCINFVLTLLSYGCII
FT                   ASVLRMRSAEGKRKAFSTCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVTSVLYSIL
FT                   SPTLNPLIYTLRNKDVKLALGRLLPFFPK"
XX
SQ   Sequence 933 BP; 187 A; 278 C; 198 G; 270 T; 0 other;
     atgttcagtc ccaaccagac agaagtgaca gagtttatac tagaagggtt ttcagaacat        60
     gctactctaa gacttctcct gacaggctgc ttcctgtccc tctacacaat cgctctaatg       120
     ggcaacattg ttatcattgc tttggtcacc tccagcactg ggctccacag tcccatgtac       180
     tttttcctgt gcaacctggc caccatggac attgtgtgca cctcctctgt gattcctaag       240
     gccctgattg gcctagtgtc tgaagaaaac accatctcct tcaaaggatg catggctcag       300
     ctcttctttc ttctgtggtc cttgtcttcg gagctgctgc tgctcacggt catggcctat       360
     gaccgctatg tggccatctg ctttcccctg cactacagct ctagaatgag cccacagctc       420
     tgtggggccc tggccgtggg tgtatggtcc atctgtgctg tgaatgcatc tgtgcacact       480
     ggcctgatga cacggctgtc attctgtggc cccaaggtca tcacccactt cttctgtgag       540
     attcccccac tcctcctgct ttcctgtagt cccacataca ttaatagcgt tatgacactt       600
     gtggcagatg ccttttatgg gtgcatcaac tttgtgctaa ccttgttatc ctatggctgc       660
     atcattgcca gtgttctgcg catgcgttct gctgagggca agaggaaggc cttttctacc       720
     tgttcatccc acctcatcgt ggtctcagtg tactactcat ctgtgttctg tgcctatgtc       780
     agtcctgcct ccagctacag cccagaaaga agcaaagtta cctccgtgct gtactcgatc       840
     ctcagcccaa ccctgaaccc cctcatctat acactaagga acaaggatgt caaactcgcc       900
     ctgggaagac tcttgccctt tttccccaag tag                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page