(data stored in ACNUC15260 zone)

EMBL: AY317653

ID   AY317653; SV 1; linear; genomic DNA; STD; MUS; 933 BP.
XX
AC   AY317653;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr45 (Olfr45) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-933
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-933
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; 5929f5a84f727719f6f48379de1a1381.
DR   EuropePMC; PMC4735795; 26832639.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..933
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="7E3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>933
FT                   /gene="Olfr45"
FT                   /note="synonyms: GA_x6K02T2PBJ9-42837030-42837962, B6,
FT                   MOR253-2, GA_x5J8B7W3EKE-4553222-4552290"
FT   mRNA            <1..>933
FT                   /gene="Olfr45"
FT                   /product="olfactory receptor Olfr45"
FT   CDS_pept        1..933
FT                   /codon_start=1
FT                   /gene="Olfr45"
FT                   /product="olfactory receptor Olfr45"
FT                   /db_xref="GOA:Q7TRT0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRT0"
FT                   /protein_id="AAP71035.1"
FT                   /translation="MLRLNQTEVTEFVLEGFSEHPDLRLFLIGCFLTLYIMALMGNILI
FT                   IALVTSSTGLHNPMYFFLCNLATTDILCTSSVIPKALVGLVSEENTISFKECMSQLFFL
FT                   AWSASSELLLLTVMAYDRYVAICCPLHYSSRMSPQMCGALAMGVWSISAVNASVHTGLM
FT                   TRLSFCGPKVITHFFCEIPPLLLLSCSPTYVNTIMTLLGDSFFGGVNFVLTLLSYGCII
FT                   ASILRMRSAEGKRKAFSTCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVTSVLYSIV
FT                   SPTLNPLIYTLRNKDVKLALGRILASFSH"
XX
SQ   Sequence 933 BP; 190 A; 260 C; 203 G; 280 T; 0 other;
     atgttgagac tcaaccagac agaagtaaca gagtttgtgc tggaagggtt ctcagagcac        60
     cctgatctaa gattgttcct gataggctgc ttcttgaccc tctacataat ggctctgatg       120
     ggcaacattt tgatcatcgc tttggttacc tccagcactg ggctccacaa tcccatgtac       180
     tttttcctgt gcaacctggc taccacggat attttgtgca cctcctctgt gattcctaag       240
     gccttggttg gcctagtgtc tgaggaaaac actatctcct tcaaggaatg tatgtctcag       300
     ctcttcttcc ttgcatggtc agcatcttct gagctgctgc tgctcacggt catggcctat       360
     gaccgctatg tggccatctg ctgtcccctg cactacagct ctaggatgag cccacagatg       420
     tgtggggccc tggccatggg tgtatggtcc atcagtgctg tgaatgcatc tgtgcacact       480
     ggcctgatga cacggctgtc attctgtgga cccaaggtca tcacccactt cttctgtgag       540
     attcccccac tcctcctgct ctcctgtagt cctacatatg taaataccat tatgactctt       600
     ttgggagatt ccttttttgg aggcgtcaat tttgtgctta ccttgctatc ctatggctgc       660
     atcattgcca gcatcctgcg catgcgttct gctgagggca agaggaaggc cttttctacc       720
     tgctcatccc acctcattgt ggtctctgtg tactactcat ctgtgttctg tgcctatgtc       780
     agccctgctt ccagctacag tccagaaaga agcaaagtta cctcagtgtt atactcgatc       840
     gtcagcccaa ccctcaaccc cctcatctat acactgagga acaaggatgt caagcttgcc       900
     ttgggcagaa tattggcctc tttctcacat taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page