(data stored in ACNUC15260 zone)

EMBL: AY317890

ID   AY317890; SV 1; linear; genomic DNA; STD; MUS; 918 BP.
XX
AC   AY317890;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   27-APR-2004 (Rel. 79, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor Olfr99 (Olfr99) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-918
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-918
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; 439e0a461cf0ddef1efc83fccabe78b7.
DR   Ensembl-Gn; ENSMUSG00000061972; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023707; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023665; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023636; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023671; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023434; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024109; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022919; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023411; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023536; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023509; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023614; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023532; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024155; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022666; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022985; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000077585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216328; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0047685; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0047665; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0047626; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0047631; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0047364; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048114; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0047426; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0047298; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0047397; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0047365; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0047500; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0047373; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048210; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047008; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0046686; mus_musculus_wsbeij.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..918
FT                   /organism="Mus musculus"
FT                   /chromosome="17"
FT                   /map="17C"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>918
FT                   /gene="Olfr99"
FT                   /note="synonyms: GA_x6K02T2PSCP-1720261-1719344, MOR156-1,
FT                   GA_x5J8B7W5KGR-1226275-1227192"
FT   mRNA            <1..>918
FT                   /gene="Olfr99"
FT                   /product="olfactory receptor Olfr99"
FT   CDS_pept        1..918
FT                   /codon_start=1
FT                   /gene="Olfr99"
FT                   /product="olfactory receptor Olfr99"
FT                   /db_xref="GOA:Q8VFE4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2177482"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFE4"
FT                   /protein_id="AAP71221.1"
FT                   /translation="MNCSQAPTLILLGLSSDAEKWQPLFSIFLVIYLLGLLGNLLLLLA
FT                   IGTDVHLHTPMYFFLSQLSFVDLCFITTTAPKMLEALWTGDGSISFSGCLTQLYFFAVF
FT                   ADMDNLLLAVMAIDRYAAICHPLRYSALMTPFRCGVLVSGSWGVTNCVSLTHTLLLSKL
FT                   YFHTNQEIPHFFCEFGPLLLLSCSDTHLNKILVIILVGILGISAVLCIVSSYGCIFYAV
FT                   AKVPSAQGKRKALSTCSSHLSVVLLFYSTVFATYLKPPSSSRSSEEVVAAVMYSLVTPT
FT                   LNPFIYSLRNKDVKSSLRRILNME"
XX
SQ   Sequence 918 BP; 196 A; 221 C; 188 G; 313 T; 0 other;
     atgaactgca gtcaggctcc tacattaatc ctcttgggac tgtctagtga tgcagagaaa        60
     tggcagcccc tctttagcat cttccttgtt atctacttgc tgggtctctt agggaacctg       120
     ctacttttgt tagctattgg cactgatgtc cacctccaca cccccatgta tttcttcctc       180
     agtcagctct catttgtgga tctttgcttc atcaccacca cagcccctaa aatgctggag       240
     gctctgtgga ctggagatgg atcaatctca ttctctggat gcctaactca gttgtacttc       300
     tttgctgttt ttgctgacat ggataacctg cttctagcag tcatggctat tgacaggtat       360
     gccgctatct gtcatccact gcgctactca gctctcatga ctccttttag atgtggggtt       420
     ctagtcagtg ggtcatgggg agtaactaat tgtgtgtctc tgacccatac tttgttgctc       480
     tctaagttat atttccatac caatcaagag attcctcatt ttttctgtga atttgggcct       540
     ctcttattgc tttcctgctc agatactcac ctcaataaaa tcctggtgat aattttggtt       600
     ggaattttag gaatcagtgc ggttctctgc attgtaagtt cttatggttg tattttttat       660
     gctgtggcta aggttccatc agcacagggg aaaaggaaag cattgtccac gtgcagttcc       720
     cacctctctg tagtcctcct tttctacagc acagtctttg ctacctacct gaagccccca       780
     tctagttctc gttcctctga ggaggtggta gctgctgtca tgtattctct cgtaactccc       840
     actctgaatc ccttcattta tagtctgaga aataaggatg ttaagagttc attgaggaga       900
     atcctaaaca tggagtag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page