(data stored in ACNUC7820 zone)

EMBL: AY317901

ID   AY317901; SV 1; linear; genomic DNA; STD; MUS; 930 BP.
XX
AC   AY317901;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr107 (Olfr107) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-930
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-930
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; c30f8e876d4e242e12846724854d94cc.
DR   Ensembl-Gn; ENSMUSG00000063188; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023711; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023669; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023640; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023675; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023437; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024113; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022923; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023414; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023540; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023513; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023618; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023536; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024159; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022670; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022987; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000077008; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215947; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215974; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216844; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0047690; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0047670; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0047631; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0047636; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0047368; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048119; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0047431; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0047302; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0047402; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0047370; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0047505; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0047378; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048215; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047013; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0046689; mus_musculus_wsbeij.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..930
FT                   /organism="Mus musculus"
FT                   /chromosome="17"
FT                   /map="17C"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>930
FT                   /gene="Olfr107"
FT                   /note="synonyms: GA_x6K02T2PSCP-1867165-1868094, MOR156-3,
FT                   GA_x5J8B7W5KGR-1086717-1085788"
FT   mRNA            <1..>930
FT                   /gene="Olfr107"
FT                   /product="olfactory receptor Olfr107"
FT   CDS_pept        1..930
FT                   /codon_start=1
FT                   /gene="Olfr107"
FT                   /product="olfactory receptor Olfr107"
FT                   /db_xref="GOA:Q7TRK4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2177490"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRK4"
FT                   /protein_id="AAP71229.1"
FT                   /translation="MNCSKTPGFILLGLSSDPEKWQPLFNIFLCLYLLGLLGNLLLLLA
FT                   IGTDVHLHTPMYFFLSQLSLVDLCFITTTAPKMLEALWTGDGSISFSGCLTQFYFFAVF
FT                   ADMDNLLLAVMAIDRYAAICHPLFYPFLMTPCRCEVLASGSWGIAHCVSLFYTLLLSQF
FT                   YYHTNQGIPHFFCDSRPLLLLSCSDTHLSEGLMMALSGVLGMSSVLCLVSSYGCIFYAV
FT                   ARVPSAQGKRKALATCSSHLSVVLLFYSTVFATYLKPPSTSHSSAEVVAAVMYTLVTPT
FT                   LNPFIYSLRNKDVKSSLRKILNMDKFQG"
XX
SQ   Sequence 930 BP; 192 A; 236 C; 188 G; 314 T; 0 other;
     atgaactgta gtaagactcc tggctttatc ctgttgggac tttccagtga cccagagaaa        60
     tggcagcccc tctttaatat tttcctctgt ctctacttgc tgggcctttt agggaacctg       120
     ctacttctgt tagctattgg cactgatgtc cacctccaca cccccatgta tttcttcctc       180
     agtcagctct cactagtgga tctttgcttc atcaccacaa cagcccctaa aatgctggag       240
     gctctgtgga ctggagatgg atcaatctca ttctctggat gcctgactca gttttacttc       300
     tttgctgttt ttgctgacat ggataacctg cttctggcag tcatggctat tgaccgctat       360
     gctgctatct gccaccccct gttctaccca tttctaatga ctccttgtag atgcgaagtt       420
     cttgccagtg ggtcatgggg aatagctcat tgtgtgtctc tgttctatac cttattactc       480
     tctcagtttt attatcatac caatcaaggg atacctcatt ttttctgtga ttctaggcct       540
     ctcttactgc tttcttgctc agacactcac ctcagtgagg gcctgatgat ggctttgtct       600
     ggagttttgg gaatgagctc agttctctgt cttgtaagtt cttatggttg tattttttat       660
     gctgtggcta gggttccatc agcacagggg aaaaggaaag ccctggccac atgcagttcc       720
     cacctctctg tagtcctcct attctatagc acagtctttg ctacctacct gaagccccca       780
     tctacttctc actcctctgc agaggtggta gctgctgtta tgtatacctt ggttactccc       840
     actctgaacc ccttcattta tagtcttaga aataaggatg ttaagagttc attgagaaag       900
     atcctgaaca tggacaagtt tcagggctaa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page