(data stored in ACNUC7820 zone)

EMBL: AY317924

ID   AY317924; SV 2; linear; genomic DNA; STD; MUS; 927 BP.
XX
AC   AY317924;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   27-APR-2004 (Rel. 79, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr128 (Olfr128) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-927
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-927
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-927
RA   Young J.M.;
RT   ;
RL   Submitted (19-APR-2004) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; 4006037e6152e4c87cce03b3ff3a665c.
DR   Ensembl-Gn; ENSMUSG00000059030; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0023689; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023660; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023459; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_CBAJ_G0023434; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023556; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000080231; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216440; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0047693; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0047654; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0047392; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_CBAJ_T0047324; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0047401; mus_musculus_nodshiltj.
XX
CC   On Apr 19, 2004 this sequence version replaced gi:32060988.
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..927
FT                   /organism="Mus musculus"
FT                   /chromosome="17"
FT                   /map="17C"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>927
FT                   /gene="Olfr128"
FT                   /note="synonym: GA_x6K02T2PSCP-2374126-2375048"
FT   mRNA            <1..>927
FT                   /gene="Olfr128"
FT                   /product="olfactory receptor Olfr128"
FT   CDS_pept        1..927
FT                   /codon_start=1
FT                   /gene="Olfr128"
FT                   /product="olfactory receptor Olfr128"
FT                   /db_xref="GOA:Q7TRJ1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2177511"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRJ1"
FT                   /protein_id="AAP71250.2"
FT                   /translation="MTPRNMTTMSGFLLMGFSDNHELQILQALLFLLTYLLGSAGNFII
FT                   ITITTLDPQLQSPMYYFLKHLSILDLSSLSVTVPQYVDSSLARSGYISYGQCMLQIFFF
FT                   TGLAWSEVALLTVMSYDRYVAICLPLHYEVIMSPRKCTWAVAAVWLSGGISGTLFTAST
FT                   LSIRFCGHKIIHQFFCDIPQLLKLSCSNDDFGLLKVSTFIAVMGFACFMGIAFSYGQIF
FT                   STVLRMPSAEGRSKVFSTCLPHLFVVSFFLSTGICAYLKPTSDSPTTLDFMLSIFYTVL
FT                   PPTLNPVIYSLRNQSLKRAIKKLLLSE"
XX
SQ   Sequence 927 BP; 219 A; 245 C; 178 G; 285 T; 0 other;
     atgactccaa gaaacatgac aacaatgagt ggattcctcc tcatggggtt ctctgacaac        60
     catgagctgc agatcttaca ggctttgctg tttttgctga catacctatt gggctcagca       120
     gggaacttca tcattatcac catcacaaca ctggacccac agctccagtc tccaatgtat       180
     tactttctga agcacctttc cattctggac ctctcatccc tctctgtcac agtcccccag       240
     tatgttgaca gttccctggc acgaagtggc tacatttcat atgggcagtg catgctgcag       300
     atatttttct tcacaggttt ggcctggagt gaggtggccc ttcttacagt gatgtcttat       360
     gaccgctatg tggccatctg cctcccactg cactatgagg tcataatgag tcccagaaag       420
     tgcacttggg ctgtggcagc tgtgtggcta agtggaggta tctcaggaac attattcaca       480
     gcaagtacac tctctatcag attctgtggg cacaaaatta ttcaccagtt cttctgtgat       540
     atcccgcaat tgctcaagct ctcctgctct aatgatgact ttggactact gaaagtgtct       600
     actttcattg ctgtaatggg atttgcctgc tttatgggga ttgccttctc ctatggccaa       660
     atattctcta cagttctcag gatgccctct gctgaaggcc gatctaaggt cttctccacc       720
     tgcctgcccc atcttttcgt tgtttcattt tttctctcaa caggcatttg tgcctatcta       780
     aagccaacct cagactcacc aactacttta gacttcatgc tctctatctt ttacacagta       840
     ctacccccaa ccctcaaccc tgttatctat agtctgagaa accagtcctt gaaaagagct       900
     ataaagaagt tactgttaag tgaataa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page