(data stored in ACNUC7820 zone)

EMBL: AY317925

ID   AY317925; SV 1; linear; genomic DNA; STD; MUS; 972 BP.
XX
AC   AY317925;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr761 (Olfr761) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-972
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-972
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; 5e36e12f214a6abaf40510230a9d1e54.
DR   Ensembl-Gn; ENSMUSG00000109376; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0023691; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023662; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_CBAJ_G0023435; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023532; mus_musculus_fvbnj.
DR   Ensembl-Tr; ENSMUST00000049620; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0047695; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0047656; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_CBAJ_T0047325; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_FVBNJ_T0047392; mus_musculus_fvbnj.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..972
FT                   /organism="Mus musculus"
FT                   /chromosome="17"
FT                   /map="17C"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>972
FT                   /gene="Olfr761"
FT                   /note="synonyms: GA_x6K02T2PSCP-2403971-2403000, MOR218-5P,
FT                   GA_x5J8B7W5KGR-563681-564305"
FT   mRNA            <1..>972
FT                   /gene="Olfr761"
FT                   /product="olfactory receptor Olfr761"
FT   CDS_pept        1..972
FT                   /codon_start=1
FT                   /gene="Olfr761"
FT                   /product="olfactory receptor Olfr761"
FT                   /db_xref="GOA:Q7TRJ0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030595"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRJ0"
FT                   /protein_id="AAP71251.1"
FT                   /translation="MTARNMTTMSGFLLVGFSDNHELQILQALLFLVTYLLGSAGNFII
FT                   ITITTLDPQLQSPMYYFLKHLSILDLSSLSVTIPQYVDSSLARSGYISYAQCMLQIFFF
FT                   ASFAWGELGTLTVMSYDRYVAICLPLHYEVIMSPRKCTWAVAAVWLSGGISGTLFTAST
FT                   LSIRFCGDKIIHQFFCDIPQLLKLSCSNDDFGVLEVSIFMAVMAFACFMGIAFSYGQIF
FT                   STVLRMPSAEGRSKVFSTCLPHLFVVSFFLSTGSCAYLKPTSDSPTASDLMLSIFYTVL
FT                   PPTLNPFIYSLRNKSLKEAVKKLLLSEELVGKIYVCSVFSAC"
XX
SQ   Sequence 972 BP; 225 A; 243 C; 192 G; 312 T; 0 other;
     atgactgcaa gaaacatgac aacaatgagt ggattcctcc tcgtggggtt ctctgacaac        60
     catgagctgc agatcttaca ggctttgctc ttcttggtga catacctatt gggctcagca       120
     gggaacttca ttattatcac catcacaaca ctggatccac agctccagtc tccaatgtat       180
     tactttctga agcacctttc cattctggac ctctcatccc tctctgtcac aattccccag       240
     tatgttgaca gttccctggc acgaagtggc tacatttcat atgcacagtg catgcttcag       300
     atttttttct ttgcatcttt tgcctgggga gagctgggca ctctcacagt gatgtcttat       360
     gaccgctatg tggccatctg cctcccactg cactatgagg tcataatgag tcccagaaag       420
     tgcacttggg ctgtggcagc tgtgtggcta agtggaggta tctcaggaac attattcaca       480
     gcaagtacac tctctatcag attctgtggg gacaaaatta ttcaccagtt cttctgtgat       540
     atcccgcaat tgctcaagct ctcctgctct aatgatgact ttggagtact ggaagtgtct       600
     attttcatgg ctgtaatggc ctttgcctgc tttatgggga ttgctttctc ctatggccag       660
     atattctcta cagttctcag gatgccctct gctgaaggca gatctaaggt cttctccacc       720
     tgcctgcccc atcttttcgt tgtttcattt tttctctcaa caggcagttg tgcctatcta       780
     aagccaacct cagactcacc aactgcttca gacctcatgc tctctatctt ttacacagta       840
     ttacccccaa ctctcaaccc ctttatctat agtctgagaa ataagtcctt gaaagaagct       900
     gtaaagaagt tattgttaag tgaagaatta gttgggaaaa tttatgtttg ttctgttttt       960
     agtgcctgct aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page