(data stored in ACNUC7820 zone)

EMBL: AY318006

ID   AY318006; SV 1; linear; genomic DNA; STD; MUS; 939 BP.
XX
AC   AY318006;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr830 (Olfr830) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-939
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-939
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; dc6ff23930b0ff59ec789c122d8fbfab.
DR   Ensembl-Gn; ENSMUSG00000062868; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034382; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034361; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034288; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034353; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034066; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034876; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033392; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034039; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034196; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034140; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034282; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034185; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034895; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033098; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033509; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000212723; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091283; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0091359; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0091300; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091286; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090861; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091810; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091443; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0090789; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0091004; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0090836; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0091022; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090857; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0092123; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090883; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089895; mus_musculus_wsbeij.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..939
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /map="9A5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>939
FT                   /gene="Olfr830"
FT                   /note="synonyms: GA_x6K02T2PVTD-12618399-12619337,
FT                   MOR152-1, GA_x5J8B7W6RL5-13964024-13963086"
FT   mRNA            <1..>939
FT                   /gene="Olfr830"
FT                   /product="olfactory receptor Olfr830"
FT   CDS_pept        1..939
FT                   /codon_start=1
FT                   /gene="Olfr830"
FT                   /product="olfactory receptor Olfr830"
FT                   /db_xref="GOA:Q7TRH0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030664"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRH0"
FT                   /protein_id="AAP71318.1"
FT                   /translation="MEVENKSVVLDIFLHGLTNDPELQPFIFVLFLSIYLITVSGNLLI
FT                   MLAIKCDFHLHNPMYFFLCHLSFNDMYLISITVPKMLMNIQTKDQRITFAGCLSQACFV
FT                   VVCTIFECFLLGVMAYDRYIAICYPLRYTVLMNPSFCVILVLFSLFFSIVNGLLHSLMV
FT                   LYLSFCTDLEILHFFCEIAQILKLACSDSLINNILIFVTASIFAGLPLFAIIFSYTHIV
FT                   STVLKMPSSEGKYKAFSTCGSHLSVVSLFYGTGFGVYITSKVIDSPKKIAVASVMYSVV
FT                   PPMLNPFVYCLRNRDMKEALKKVIGRTASLL"
XX
SQ   Sequence 939 BP; 233 A; 193 C; 171 G; 342 T; 0 other;
     atggaagttg aaaacaaatc agttgttttg gatatttttc tacatggact cacaaatgac        60
     ccagagctgc agccattcat ctttgttctt tttctaagca tatacttgat taccgtttct       120
     ggaaatcttc ttataatgtt ggccatcaag tgtgacttcc atcttcacaa ccccatgtac       180
     ttctttctct gtcatctgtc ttttaatgac atgtatttaa tcagcatcac agtcccaaag       240
     atgttgatga atatacaaac aaaagatcag aggataactt ttgctggctg cctcagccag       300
     gcctgctttg ttgtagtttg tacaatattt gaatgttttc tccttggagt aatggcttat       360
     gatcgctaca tagccatttg ttatcctcta agatacacag tccttatgaa ccccagtttc       420
     tgtgttattc tggttctttt ctctctattc tttagtattg taaatggtct gctgcatagt       480
     ctgatggtgc tgtacttgtc cttctgcaca gacctggaaa tcctccactt cttctgtgaa       540
     attgcacaaa tcctgaagct tgcctgttct gacagcctca tcaacaacat cctgatattt       600
     gttacagctt ctatttttgc tggtcttcct ctgtttgcaa taatcttttc ttatactcat       660
     attgtgtcta cagtattgaa aatgccatca tcagaaggaa agtacaaagc cttttccacc       720
     tgtgggtctc atttgtcagt tgtttcctta ttctatggga cagggtttgg tgtatacatt       780
     acctcaaaag taattgattc accaaagaag attgctgtgg cttcagtgat gtattcagta       840
     gttcctccaa tgttgaatcc ctttgtctat tgtttgagga acagggatat gaaggaggcc       900
     ctgaagaaag ttattggtag gacagcttct cttctgtga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page