(data stored in ACNUC7820 zone)

EMBL: AY318012

ID   AY318012; SV 1; linear; genomic DNA; STD; MUS; 945 BP.
XX
AC   AY318012;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr836 (Olfr836) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-945
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-945
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; 8a5256e6ed79c05349e9a665a4475427.
DR   Ensembl-Gn; ENSMUSG00000059303; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212730; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215981; mus_musculus.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..945
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /map="9A5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>945
FT                   /gene="Olfr836"
FT                   /note="synonyms: GA_x6K02T2PVTD-12857805-12858749,
FT                   MOR152-3, GA_x5J8B7W6RL5-13729544-13728600"
FT   mRNA            <1..>945
FT                   /gene="Olfr836"
FT                   /product="olfactory receptor Olfr836"
FT   CDS_pept        1..945
FT                   /codon_start=1
FT                   /gene="Olfr836"
FT                   /product="olfactory receptor Olfr836"
FT                   /db_xref="GOA:Q7TRG6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030670"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRG6"
FT                   /protein_id="AAP71322.1"
FT                   /translation="MEVENKSVVFDIFLHGLTDDTELQPFIFGLFLCMYLITIFGNLLI
FT                   ILAIICDSHLHTPMYFFLCHLAFNDMYLISITVPKMLVNIQTQDQRITFAGCLSQGCFV
FT                   AVCTIFECFLLGIMAYDRFIAICYPLRYTVLMNPCFCVILTLISLFFSIVNGLLHSLMV
FT                   LHLSFCTDLEILHFFCEIAQILKLACSDSLINNILIFVTSSIFAGVPLCGIIFSYVHIV
FT                   STVLKMPSLEGKYKAFSTCGSHLSVVSLFYGTGFGVYISSNVIDSPKKIAMASVMYSIV
FT                   PPMMNPFIYSMRNRNMKEALKKVIGRKLLFSDV"
XX
SQ   Sequence 945 BP; 232 A; 194 C; 172 G; 347 T; 0 other;
     atggaagttg aaaacaaatc agttgttttt gatatttttc ttcatggact tacagatgat        60
     acagagcttc agccctttat ctttggcctt tttctatgca tgtatttgat caccatcttt       120
     ggaaatcttc ttataatatt ggccatcatt tgtgactctc acctccacac acccatgtac       180
     ttctttctct gccatctggc ttttaatgac atgtatttaa tcagcattac agtcccaaag       240
     atgttggtga atatacaaac acaggatcag aggatcactt ttgctggctg cctgagccag       300
     ggatgctttg ttgctgtttg taccatcttt gagtgttttc tccttggaat aatggcctat       360
     gaccgcttca tagccatttg ttatcctcta agatacacag tcctcatgaa tccctgcttc       420
     tgtgttattc tgactcttat ctctctattc tttagtattg taaatggtct gctgcatagt       480
     ctgatggtgc tgcacttgtc cttctgcaca gacctggaaa tcctccactt cttctgtgaa       540
     attgcacaaa tcctcaagct tgcctgttct gacagcctaa tcaacaacat cttgatattt       600
     gttacatctt ctatttttgc tggtgttcct ctatgtggaa taatcttttc ttatgttcac       660
     attgtttcta cagtgttgaa aatgccatca ttagaaggaa agtacaaagc cttctccacg       720
     tgtgggtctc atttatcagt tgtttccttg ttctatggga caggttttgg tgtatacatt       780
     tcctcaaatg taattgattc accaaagaag attgccatgg cttcagtgat gtattcaata       840
     gttcctccaa tgatgaatcc ctttatctat agtatgagga acaggaatat gaaagaggca       900
     ttgaagaagg taattggtag gaagcttctt ttctctgatg tgtga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page