(data stored in ACNUC15260 zone)

EMBL: AY318013

ID   AY318013; SV 1; linear; genomic DNA; STD; MUS; 939 BP.
XX
AC   AY318013;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr837 (Olfr837) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-939
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-939
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; 7ec08f3f496a660289507dec46f67ca2.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..939
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /map="9A5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>939
FT                   /gene="Olfr837"
FT                   /note="synonyms: GA_x6K02T2PVTD-12873838-12874776,
FT                   MOR152-2, GA_x5J8B7W6RL5-13713510-13712572"
FT   mRNA            <1..>939
FT                   /gene="Olfr837"
FT                   /product="olfactory receptor Olfr837"
FT   CDS_pept        1..939
FT                   /codon_start=1
FT                   /gene="Olfr837"
FT                   /product="olfactory receptor Olfr837"
FT                   /db_xref="GOA:Q7TRG5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRG5"
FT                   /protein_id="AAP71323.1"
FT                   /translation="MEVKNKSVVLDIFLHGLTDDIELQPFIFGFFLCMYLITIFGNLLI
FT                   MLAIIFDSHLHKPMYFFLCHLAFNDMYLISITVPKLLVNVQTQDQRITLAGCLSQGCFV
FT                   AVCFIFECFLLGIMAYDRYIAICFPLRYTVLINPFFCVIVVLISLFISIVNGLLHSLMV
FT                   LHLSFCTDLEILHFFCEIAQILKLACSDNLINNILIFVTASSFAGVPLCGIIFSYVHIV
FT                   STVLKMPSSEGKYKAFSTCGSHLSVVSLFYGTGFGVYITSVVIDSPKEIAIASVMYSIV
FT                   PPMLNPFVYSLKNRDMKEALKKVIGRTVSLP"
XX
SQ   Sequence 939 BP; 232 A; 192 C; 171 G; 344 T; 0 other;
     atggaagtta aaaacaagtc ggttgttttg gatattttcc ttcatggact cacagatgac        60
     atagagctgc agcccttcat ctttggcttc tttttatgca tgtatttgat caccatcttt       120
     ggaaatcttc ttataatgtt agccatcatt tttgactccc acctccacaa acccatgtac       180
     ttctttctct gccatctggc ttttaatgac atgtatttaa tcagcattac agtcccaaag       240
     ttgttggtga atgtacaaac acaggatcag aggatcactt tagctggctg tctgagccag       300
     ggatgctttg tggctgtatg tttcatcttt gaatgttttc tccttggaat aatggcctat       360
     gaccgctaca tagccatttg ttttcctcta agatacacag tcctcatcaa tcccttcttc       420
     tgtgttattg tggttctaat ctctctattt attagtattg taaatggtct gctgcatagt       480
     ctgatggtgc tgcacttgtc cttctgcaca gacctggaaa tcctccactt cttctgtgaa       540
     attgcacaaa tcctcaagct tgcctgttct gacaacctca tcaacaacat cctgatattt       600
     gttacagctt ctagttttgc tggtgttcct ctatgtggaa taatcttttc ttatgttcac       660
     attgtttcta cagtattgaa aatgccatca tcagaaggaa agtataaagc cttctctact       720
     tgtgggtctc atttatcagt tgtttcattg ttttatggga caggttttgg tgtatacatt       780
     acctcagtag taattgattc accgaaggaa attgctattg cttcagtgat gtattccata       840
     gttcctccaa tgttgaatcc ctttgtttat agtttgaaga acagggatat gaaagaagca       900
     ctgaagaagg taattggtag aacagtttct cttccatga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page