(data stored in ACNUC7820 zone)

EMBL: AY318021

ID   AY318021; SV 1; linear; genomic DNA; STD; MUS; 939 BP.
XX
AC   AY318021;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr845 (Olfr845) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-939
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-939
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; f4d9331c4c246aef2ddd50632300ae41.
DR   Ensembl-Gn; ENSMUSG00000061614; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034390; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034369; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034296; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034361; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034074; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034884; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033399; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034047; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034204; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034148; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034290; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034193; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034903; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033106; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033517; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000071259; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213344; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215572; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091291; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0091367; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0091308; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091294; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090869; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091818; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091450; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0090797; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0091012; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0090844; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0091030; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090865; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0092131; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090891; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089903; mus_musculus_wsbeij.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..939
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /map="9A5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>939
FT                   /gene="Olfr845"
FT                   /note="synonyms: GA_x6K02T2PVTD-13076685-13077623,
FT                   MOR150-2, GA_x5J8B7TY9VB-3-604, GA_x5J8B7TY9VC-3-581"
FT   mRNA            <1..>939
FT                   /gene="Olfr845"
FT                   /product="olfactory receptor Olfr845"
FT   CDS_pept        1..939
FT                   /codon_start=1
FT                   /gene="Olfr845"
FT                   /product="olfactory receptor Olfr845"
FT                   /db_xref="GOA:Q7TRG2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRG2"
FT                   /protein_id="AAP71326.1"
FT                   /translation="MESTNQTDAIEFLLLGLSDDPELQPIIFGLFLFMYLVTFLGNLII
FT                   TLTISAECHLHTPMYFFLSNLSVADICISSTTVPKMLLNIQTPDHRITYSGCLTQACFV
FT                   LLFAGLENCLLAAMAYDRYVAICHPLRYTVIMNSCFCSILIVVSLAISAVNALLLSLMV
FT                   LHLNFCTEVEIPHFFCELAQIIKLACSDTLINNILIYISAFMFGGIPFFGIFLSYTEIV
FT                   SSVLKIPSRQGRHKAFSTCGSHLSVVSLFYGTGLGVYISSAVTESPRKTAVASVMYSIV
FT                   TQMLNPFIYSLRNRDMKEALRKHVGRIASIV"
XX
SQ   Sequence 939 BP; 234 A; 217 C; 177 G; 311 T; 0 other;
     atggaatcca ccaatcaaac agatgcaata gaatttctgc tcttgggcct ttcagatgat        60
     ccagagttac agcccattat tttcggactg ttcctgttta tgtacctggt cacatttctg       120
     gggaacctaa ttataaccct gaccatcagt gctgagtgcc atctccatac ccccatgtac       180
     ttttttctct ccaatctatc tgtggctgat atctgtataa gctcaactac agtcccaaag       240
     atgctcttga acatccaaac accggatcac agaataactt actcaggttg cctcactcag       300
     gcttgctttg tcttgctttt tgctggatta gaaaattgct tgcttgcagc aatggcctat       360
     gaccgctatg tggccatttg ccaccctctg aggtacacag tcatcatgaa ctcatgcttc       420
     tgtagtatac ttattgtagt ttccttggct attagtgctg tcaatgcact actgctcagt       480
     ctcatggtgc tgcatctgaa tttctgcaca gaggttgaaa tcccacactt cttctgtgaa       540
     cttgctcaga tcataaagct tgcctgctca gatactctca taaataatat tttgatttat       600
     atctcagctt tcatgtttgg tggtattcct ttctttggaa tatttctttc ttatactgaa       660
     attgtctcct ctgttttgaa aattccatca aggcaaggaa ggcataaagc attttccacg       720
     tgtggctctc acctgtcagt agtttccttg ttttatggga caggcttagg agtgtacatt       780
     agctctgcag ttactgaatc tcccaggaaa acagccgttg cttcagtaat gtactctatt       840
     gtcactcaga tgctgaaccc ttttatctac agcctgagga acagagacat gaaggaagct       900
     ttaaggaagc acgttggaag gatagcttcc attgtataa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page