(data stored in ACNUC15260 zone)

EMBL: AY318321

ID   AY318321; SV 1; linear; genomic DNA; STD; MUS; 441 BP.
XX
AC   AY318321;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr1124 (Olfr1124) gene, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-441
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-441
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; 0f1ecbf1b91d862fd82f066b25ca09e5.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..441
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /map="2E1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>441
FT                   /gene="Olfr1124"
FT                   /note="synonym: GA_x6K02T2Q125-48935224-48935664"
FT   mRNA            <1..>441
FT                   /gene="Olfr1124"
FT                   /product="olfactory receptor Olfr1124"
FT   CDS_pept        1..>441
FT                   /codon_start=1
FT                   /gene="Olfr1124"
FT                   /product="olfactory receptor Olfr1124"
FT                   /db_xref="GOA:Q6W039"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q6W039"
FT                   /protein_id="AAS99808.1"
FT                   /translation="MNHQQKPQEGNLTNLKEFVLLGFSDVPDLQWVLFGLLIAMYCFIL
FT                   LGNGTIVLITNVDSALQTPMYFFLGNFSFLEICYVSITLPRMVFNLGTQRRTISFIACA
FT                   TQMCCILILGATECFLLAVMAYDRYVAICNPLHYPLVMNQKVC"
XX
SQ   Sequence 441 BP; 115 A; 97 C; 78 G; 151 T; 0 other;
     atgaaccatc aacaaaaacc acaagaagga aatctaacca atctgaagga atttgttctt        60
     cttggatttt cagatgttcc tgatctccag tgggttctat ttggactatt gattgctatg       120
     tattgtttca tcctattagg caatggcacc attgtactaa tcacaaacgt agactctgct       180
     cttcagaccc ctatgtactt ttttcttggt aacttttcct ttttagagat atgttatgta       240
     tcaattactc ttccaagaat ggtcttcaac cttggaacac aaagaaggac catctctttc       300
     attgcctgtg ctacacaaat gtgctgcatt cttatcctgg gagccacaga atgcttcttg       360
     ctggctgtga tggcctatga ccgttatgtt gctatctgta accccctgca ttatcctcta       420
     gttatgaacc aaaaggtgtg t                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page