(data stored in ACNUC15260 zone)

EMBL: AY318322

ID   AY318322; SV 1; linear; genomic DNA; STD; MUS; 957 BP.
XX
AC   AY318322;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   27-APR-2004 (Rel. 79, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor Olfr1125 (Olfr1125) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-957
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-957
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; c61c0fa4809c73e5452c92499fea5b26.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..957
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /map="2E1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>957
FT                   /gene="Olfr1125"
FT                   /note="synonyms: GA_x6K02T2Q125-48936945-48937901,
FT                   MOR264-3, GA_x5J8B7W3Y5M-756846-757802"
FT   mRNA            <1..>957
FT                   /gene="Olfr1125"
FT                   /product="olfactory receptor Olfr1125"
FT   CDS_pept        1..957
FT                   /codon_start=1
FT                   /gene="Olfr1125"
FT                   /product="olfactory receptor Olfr1125"
FT                   /db_xref="GOA:Q8VGT6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGT6"
FT                   /protein_id="AAP71544.1"
FT                   /translation="MNHQQKPQEGNLTNLKEFVLLGFSDVPDLQWVLFGLLIAMYCFIL
FT                   LGNGTIVLITNVDSALQTPMYFFLGNFSFLEICYVSITLPRMVFNLGTQRRTISFIACA
FT                   TQMCFTLILGATECFLLAVMAYDRYVAICNPLHYPLVMNQKVCSQLVIGSWISGIPIQI
FT                   GQTSHIFSLSFCGSNQINHFFCDIPPILHLACGDIFINEMMVFLGAFLFVLFPFMLIVF
FT                   SYSKIISTVLKLSSTKSRAKAFSTCSSHLAVVILFFGSAMITYFRSNASHSGETDKVLS
FT                   LFYTVVTPMFNPMVYSLRNKDVTIALRKFLCKQFVKI"
XX
SQ   Sequence 957 BP; 254 A; 202 C; 163 G; 338 T; 0 other;
     atgaaccatc agcaaaaacc acaagaagga aatctaacca atctgaagga atttgttctt        60
     cttggatttt cagatgttcc tgatctccag tgggttctat ttggactatt gattgctatg       120
     tattgtttca tcctattagg caatggcacc attgtactaa tcacaaacgt agactctgct       180
     cttcagacac ctatgtactt ttttcttggt aacttttcct ttttagagat atgttatgta       240
     tcaattactc ttccaagaat ggtcttcaac cttggaacac aaagaaggac catctctttc       300
     attgcctgtg ctacacaaat gtgcttcact cttatcctgg gagccacaga gtgcttcttg       360
     ctggctgtga tggcctatga ccgttatgtt gctatctgta atcccctgca ttatcctcta       420
     gttatgaacc aaaaggtgtg ttcccaactg gtgattggct cctggataag tggaatccca       480
     attcagatag ggcagacatc acatatcttt tctctgtcat tttgtggttc caaccagatc       540
     aaccacttct tctgtgatat tcccccaata cttcacctgg cctgtgggga catctttatc       600
     aatgagatga tggttttcct aggtgctttt ttatttgtct tgtttccatt catgttaata       660
     gtattttcct atagtaaaat catctctaca gtcttgaagc tatcatcaac caaaagtcga       720
     gccaaagcct tctctacttg ttcttctcat cttgcagttg tgatattatt ttttggatca       780
     gctatgatta catattttag atccaatgct agtcattcag gtgagacaga taaagttctt       840
     tctcttttct ataccgttgt gactcctatg tttaatccca tggtatacag tctaagaaac       900
     aaggatgtca caatagcact gagaaaattc ttatgcaaac aatttgtgaa aatataa          957
//

If you have problems or comments...

PBIL Back to PBIL home page