(data stored in ACNUC15260 zone)

EMBL: AY318347

ID   AY318347; SV 1; linear; genomic DNA; STD; MUS; 945 BP.
XX
AC   AY318347;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr1148 (Olfr1148) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-945
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-945
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; 53950553929bf40592880d343c3fe0f2.
DR   Ensembl-Gn; ENSMUSG00000061875; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026029; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025997; mus_musculus_aj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026002; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025757; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026449; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025216; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025736; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025866; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025831; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025968; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026501; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025288; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000077580; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215230; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0055833; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0055860; mus_musculus_aj.
DR   Ensembl-Tr; MGP_BALBcJ_T0055799; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0055519; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0056283; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0055725; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0055471; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0055575; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0055539; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0055695; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0056432; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0054800; mus_musculus_wsbeij.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..945
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /map="2E1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>945
FT                   /gene="Olfr1148"
FT                   /note="synonyms: GA_x6K02T2Q125-49334566-49335510,
FT                   MOR264-7, GA_x5J8B7W3Y5M-1117881-1118826"
FT   mRNA            <1..>945
FT                   /gene="Olfr1148"
FT                   /product="olfactory receptor Olfr1148"
FT   CDS_pept        1..945
FT                   /codon_start=1
FT                   /gene="Olfr1148"
FT                   /product="olfactory receptor Olfr1148"
FT                   /db_xref="GOA:Q7TR35"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TR35"
FT                   /protein_id="AAP71563.1"
FT                   /translation="MNHEELESINNVSTVIQFVLIGFSDLPNLQGFLFAVFSVVYIIIL
FT                   IGNFLIIIIISTDQALQKPMYFFLANFSSLEICYVSVTVPRILFNIGTQNRSISLMSCA
FT                   TQLCFFLVFGTTECLLLAVMSYDRYVAICNPLHYPLVMNPTKCTQLAAVSWLGGIPVQI
FT                   GQTCQIFSMNFCNSYKINHFFCDIPPILTLACGNTSVHELSVYVVVMVVAAFPFILVLT
FT                   SYSKIIATILRLPTAKGRGKAFSTCSSHLLVVLLFYGSATVTYLRPKSMHSPGTDKLLS
FT                   LFYTIVTPMFNPLIYSLRNKEVIAALRKLILKK"
XX
SQ   Sequence 945 BP; 249 A; 218 C; 176 G; 302 T; 0 other;
     atgaatcatg aagagctaga gtccataaac aatgtttcca cagtgataca gtttgtgctc        60
     ataggatttt ctgacctgcc caacctccaa ggatttctat ttgcagtgtt ttctgtagtt       120
     tatattatta tcttgattgg aaatttcctc ataatcataa taatcagtac ggaccaagca       180
     ttacagaaac caatgtattt ttttctggca aatttttcct ctctggaaat ctgttatgta       240
     tcagtgactg tcccaaggat tctgttcaac attgggacac agaaccgaag catttcactg       300
     atgtcctgtg ctacacaact gtgcttcttc cttgtttttg gaactactga atgtttgttg       360
     ctagctgtga tgtcctatga ccgatatgtg gccatatgca accctctgca ctatcctctg       420
     gtcatgaacc caacaaagtg cacacagctg gcagcagtct cctggcttgg aggcatccca       480
     gtccagatag gacaaacttg tcagatattc tctatgaatt tttgtaattc ttacaaaatc       540
     aaccacttct tttgtgacat accaccaatt ctcacgctgg cttgtggaaa cacttcagtg       600
     catgaattgt ctgtctatgt ggtcgttatg gtggtggctg cattcccctt tatattggtg       660
     cttacatcct acagcaaaat cattgccacc atcctgaggt tgccaacagc caaaggtcgg       720
     ggaaaagcct tctccacatg ttcttcccac ctgctggtgg tactattgtt ttatggatct       780
     gctacggtta cctatttgag accaaagtcc atgcattctc ctggaactga caaactcctg       840
     tctctgttct acaccattgt gactcccatg ttcaatccct taatatacag ccttaggaac       900
     aaggaagtga ttgctgcact gagaaagtta atactaaaaa aatag                       945
//

If you have problems or comments...

PBIL Back to PBIL home page