(data stored in ACNUC7820 zone)

EMBL: AY318559

ID   AY318559; SV 1; linear; genomic DNA; STD; MUS; 960 BP.
XX
AC   AY318559;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   27-APR-2004 (Rel. 79, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor Olfr1351 (Olfr1351) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-960
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-960
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; f063bd8a6ca03fca527226f20a5caefd.
DR   Ensembl-Gn; ENSMUSG00000063216; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017437; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017415; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017378; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017377; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017200; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017832; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016770; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017172; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017280; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017272; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017349; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017299; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017872; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016551; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016829; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000080730; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216030; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026016; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0025992; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0025958; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025961; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025767; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026452; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025334; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0025691; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0025820; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0025816; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0025930; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025812; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026500; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025043; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025304; mus_musculus_wsbeij.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..960
FT                   /organism="Mus musculus"
FT                   /chromosome="10"
FT                   /map="10B5-10C2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>960
FT                   /gene="Olfr1351"
FT                   /note="synonyms: GA_x6K02T2QGN0-2794907-2793948, OR6-8,
FT                   MOR139-4, GA_x5J8B7W5685-255053-254094"
FT   mRNA            <1..>960
FT                   /gene="Olfr1351"
FT                   /product="olfactory receptor Olfr1351"
FT   CDS_pept        1..960
FT                   /codon_start=1
FT                   /gene="Olfr1351"
FT                   /product="olfactory receptor Olfr1351"
FT                   /db_xref="GOA:Q8VGU6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031185"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGU6"
FT                   /protein_id="AAP71735.1"
FT                   /translation="MEPGNDTQLSEFFLLELSENQPQIQPLIFGLFLSMYLVTVTGNLL
FT                   IIMAITADSHLHTPMYIFLSNLSFVDICFTSTTVPQMLVTIHTQSKAITYANCITQVYF
FT                   LLLFSVLDIFLLTVMAYDHYVAICHPLHYMIIMNTRRCGLMILACWIIGVINSLLHTFL
FT                   ALRLSFCTDLEIPHFYCELNQVVHHACSDISLNDMVIYIAAMLLVVGPLSGILYSYSKI
FT                   VSSICAISSVQGKYKAFSTCASHLSVVSLFYCTLLGVYLSSAVTQNAQATALASLMYTV
FT                   VTPMLNPFIYSLRNNDMKKALKIVLGRVTRNRLTDLPS"
XX
SQ   Sequence 960 BP; 235 A; 254 C; 172 G; 299 T; 0 other;
     atggaaccag gaaatgacac tcagctttca gaattctttc ttctggaatt atcagagaat        60
     caacctcaaa ttcagcctct catatttgga ctgttccttt ccatgtacct agtgactgtc       120
     actggaaacc tactcatcat catggccatc actgccgact cccacctgca cacacccatg       180
     tacatcttcc tctctaatct gtcctttgtg gacatctgct ttacttccac cactgttcca       240
     cagatgctgg tgaccattca cacacagagc aaggccatca cctatgcaaa ctgcatcacc       300
     caggtatact ttttactact tttttcggta ctggacatct ttctgctgac tgtgatggcc       360
     tatgaccact atgtggccat ctgtcacccc ctgcattaca tgatcatcat gaacacaaga       420
     cgctgtggat tgatgattct ggcatgctgg attataggtg ttataaattc cctgttacac       480
     acctttttgg cattacggct gtcattctgc acagacctgg agatccctca cttttactgt       540
     gaacttaatc aagttgtaca ccatgcctgt tctgacatct ctcttaatga catggtgatt       600
     tacattgcag ctatgctact ggttgtggga cccctctctg gtatccttta ctcttactct       660
     aagatagtgt cctccatttg tgcaatctcc tcagtgcagg ggaagtacaa agcattttcc       720
     acctgtgcat ctcacctctc agttgtctcc ttattttatt gtaccctcct gggagtgtac       780
     ctcagttctg ctgtgactca aaatgcacag gccactgcat tggcttcact gatgtacact       840
     gtggtcaccc ccatgctgaa cccattcatc tatagtttaa ggaataatga catgaaaaag       900
     gctctgaaaa tagttttagg gagggtaact agaaacagac taacggactt accttcttag       960
//

If you have problems or comments...

PBIL Back to PBIL home page